tan




FC2HUNTBDASDVENXKSBJAMBILULUVENUHMNSQTEATIDHDKAGVHSTARSSPRDHNDAPODSANSDABAUKGMIDE

2020-09-12
158 min

[IPX-542]"If You've Missed Your Last Train Home, Why Don't You Cum Over To My Place？" My Lover Is Waiting At Home For Me, But After Missing The Last Train Home, I Ended Up Spending The Night At My Beautiful Lady Boss' Place... She

  • airi kijima eri kuriyama censoredcreampieblowjobIPXidea pocketkahori maedanodishIPX-542IPX542ipx00542
    • 2020-09-19
    60 min

    HEYZO 2355 Orgasms With A Horny Pussy Girl Vol.6 – Reika Kudo

  • reika kudo uncensoredcreampieheyzo
    • 2020-09-24
    138 min

    [HBAD-556]I Could Not Refuse This Sexual Frustrated Wife With Colossal Tits - Ena Koume

  • ena koume censoredsingle workHBADhibinorokutanzo no seishibabeHBAD-556HBAD5561hbad00556
    • 2020-10-08
    67 min

    FC2PPV 1527417 [First shot] [Appearance] The highest class vaginal pressure pussy ever! ？？ While the bewitching mature woman with the finest slender body trembles the whole body, the trained abdominal muscles float continuously cum ♡ Creampie Tokuno

  • amateur uncensoredfc2
    • 2020-10-10
    159 min

    [JUFE-212]A Video Record Of Warped Love A Plain Jane Female S*****t With Big Tits Gets Domestication Breaking In Training For 20 Days Until She Descends In Orgasmic Pleasure Hinata Koizumi

  • hinata koizumi censoredbig titsbeautiful girlJUFEfitchJUFE-212JUFE212jufe00212
    • 2020-10-12
    54 min

    FC2PPV 1531749 [Limited quantity 2980pt → 1980pt] That super famous doujin AV actress volunteers for a massage model ❤️ Rubbing beautiful big tits covered with oil ❤️ Screaming with brain juice in hell that can not be squid ❤️ There is a vaginal cum

  • amateur uncensoredfc2
    • 2020-11-06
    114 min

    [SHKD-911]She Was Trying To Avenge Her Father, But... This Female Detective Was Captured By The Sinister Organization, And Subjected To Sex For A Year Minori Hatsune

  • hatsune minori censoredbig titssingle workSHKDattackerskinsharkSHKD-911SHKD911shkd00911
    • 2020-11-09
    25 min

    FC2PPV 1563955 [Personal shooting] A young wife who loves other sticks despite being a married woman.

  • amateur uncensoredfc2
    • 2020-11-10
    75 min

    200GANA-2383 Seriously Nampa, first shot. 1551 Successful pick-up of a fluffy maid girl! Do you say that you like naughty things？ It seems that it is not full if you wrap around behind and rub your boobs … If you give out a big ○ N, you will ser

  • amateur censoredamateurganagana-2383gana2383200gana-2383
    • 2020-11-13
    94 min

    SMUK-030 Kurumi 2

  • amateur censoredschoolgirlamateursmuksmuk-030smuk030smuk-030
    • 2020-11-13
    120 min

    [MEYD-632]She Applied At A Porn Label To Work The Cameras, But Before She Knew It This Married MILF Assistant Director Was The Star Of The Show Herself Nanami Kawakami

  • kawakami nanami censoredmarried womandramaMEYDtameike gorohiroharu osakiMEYD-632MEYD632meyd00632
    • 2020-12-07
    48 min

    [gerk-333]ありさお姉ちゃん

  • amateur censoredcreampieamateurgerkgerk-333gerk333gerk-333
    • 2020-12-20
    140 min

    [DASD-787]Fresh Face: The Mysterious Beautiful Girl With Pink Nipples Hinata

  • censoredbeautiful girlDASDdasrokusaburo mishimaDASD-787DASD787dasd00787
    • 2020-12-25
    59 min

    [WKD-037]Fallen Woman June Lovejoy

  • june lovejoy censoredslutsingle workWKDwaap entertainmentk westwWKD-037WKD0372wkd00037
    • 2021-01-01
    101 min

    [VENU-994]Seduced By My Sister-In-Law's Big Tits - My Sexy Sister-In-Law (Who Was Actually Just Horny From Her Sexless Bedroom) Comforted Me When I Got Dumped By My Girlfriend - Asuka Kiyomiya

  • kiyomiya asuka censoredcreampiebig titsVENUvenuspeterfakecest winntersVENU-994VENU994venu00994
    • 2021-01-01
    144 min

    [GOJU-176]Picking Up Hot MILF For Sex - Frustrated, Horny Mature Hotties Pounded Mercilessly Until They Cum!

  • censoredcreampieamateurGOJUisojinGOJU-176GOJU176h-1165goju00176
    • 2021-01-14
    125 min

    [FGAN-032]A Beautiful Girl Who Makes Men Get Erections Unintentionally

  • aya mamiya censoredcosplaysingle workFGANfetish eyesFGAN-032FGAN032h-1440fgan00032
    • 2021-01-16
    310 min

    [HUNTA-934]"Uncle, It Tickles When You Touch Me There..." I Tried Groping My Growing Step-Niece's Tits From Behind, And Not Only Did She Not Resist, She Wanted More...

  • censoredcreampieschoolgirlHUNTAhuntervolvo nakanohhh groupHUNTA-934HUNTA934hunta00934
    • 2021-01-16
    115 min

    [RKI-606]Fucking My Girlfriend As Much As You Want Will Cost You. Want Some？ Inori Fukazawa

  • fukasawa inori censoredcreampiebig titsRKIrookietake dRKI-606RKI606rki00606
    • 2021-01-21
    213 min

    [DANDY-747]It's great fucking a serious woman ! Neat and Clean Looking Nurse Turns out to be a Crazy Slut vol. 4

  • censoredblowjobslutDANDYdandymongolian sanoDANDY-747DANDY7471dandy00747
    • 2021-02-08
    82 min

    498DDH-001 Frustrated tipsy female boss is reverse sexual harassment! ？？ Became a shared room at a hotel on a business trip, straddling a busty boss who flickers a woman’s face and raw SEX until morning

  • amateur censoredcreampiebig titsddhddh-001ddh001498ddh-001
    • 2021-02-11
    67 min

    435MFC-080 [Gonzo with beautiful breasts] Gonzo with a selfish body erotic girl with beautiful breasts / Waka / 23 years old / G cup (big breasts)

  • amateur censoredcreampiebig titsmfcmfc-080mfc080435mfc-080
    • 2021-02-16
    111 min

    [MXGS-1170]I Met My Female Friend For The First Time In A Long While, And Her Tits Have Gotten So Big I Can't Help But Get Excited... Sachiko

  • sachiko censoredbig titsbeautiful girlMXGSmaxingMXGS-1170MXGS1170h-068mxgs01170
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-21
    120 min

    [JUL-479]During Our Business Trip, To My Great, Great, Surprise, I Was Booked Into The Same Business Hotel Room With My Favorite Lady Boss Honoka Kimura

  • honoka kimura censoredmature womansingle workJULmadonnamametaro mamezawaJUL-479JUL479jul00479
    • 2021-03-14
    50 min

    492MERC-254 Smaller Than Small Tits

  • amateur censoredsquirtingamateurmercmerc-254merc254492merc-254
    • 2021-03-14

    FC2PPV 1726550 Limited number [Uncensored] Big breasts J cup that child, fucking cum shot

  • amateur uncensoredfc2
    • 2021-03-19
    120 min

    [SUJI-130]Stepdaddy's A Pervert! Filthy Acts Continuously Committed On His Beloved Stepdaughter

  • censoredcreampieSUJIkanranshaSUJI-130SUJI130suji00130
    • 2021-04-02
    233 min

    [HEZ-266]Car Sex Challenge! Sumire Niwa / Shion Sato

  • niwa sumire sato white sound censoredmature womanHEZhot entertainmentHEZ-266HEZ26659hez00266
    • 2021-04-10
    114 min

    [BAHP-072]STRAWBERRY PUSSY AZUMA NOZOMI Nozomi Azuma

  • nozomi higashi censoredcreampiesingle workBAHPbaltandaibutsu yoshidahoppinBAHP-072BAHP072bahp00072
    • 2021-04-27
    40 min

    FC2PPV 1789602 [Gonzo] 145 cm mini girl! 〇〇, let’s start here! From scratch! 【selfie】

  • amateur uncensoredfc2
    • 2021-05-08
    103 min

    [NSPS-990]Wife Is Fucked By Her Husband's Boss And Gets Pregnant 2 Haruka Noki

  • haruka nogi censoredmature womansingle workNSPSnagae stylenagaeNSPS-990NSPS990nsps00990
    • 2021-05-15
    91 min

    FC2PPV 1818561 A beautiful teacher in the health room of a prestigious university graduate. Sweaty sex that released desires, a large amount of vaginal cum shot in a big pussy & a large amount of facial cumshots in black glasses with a thick blowj

  • amateur uncensoredfc2
    • 2021-05-19
    48 min

    FC2PPV 1825061 [No] [Appearance] Two consecutive vaginal cum shots for an amateur woman who has no shooting experience! I am happy with the rich Gonzo of reason collapse ♡

  • amateur uncensoredfc2
    • 2021-05-29
    124 min

    [XVSR-593]Steamy Sex MAX-A Exclusive Actresses Ichika Mogami's First Time Having Real Adult Sex

  • ichibana mogami hana sato censoredbig titssquirtingXVSRmax ak c takedacalenXVSR-593XVSR593xvsr00593
    • 2021-06-15
    91 min

    [THNIB-072]Ultimate Girlfriend. /Miu

  • censoredbig titsbeautiful girlTHNIBcraneTHNIB-072THNIB072h-706thnib00072
    • 2021-06-22
    73 min

    FC2PPV 1881361 [Sister bowl] Sister 3PAV debut. Bring Miriya’s older sister and virgin kun 3P harem creampie * Complete appearance

  • amateur uncensoredfc2
    • 2021-07-18
    65 min

    421OCN-021 Mai-Chan (Mai Araki)

  • amateur censoredcreampieamateurocnocn-021ocn021421ocn-021
    • 2021-08-06
    55 min

    480FRIN-044 << Personal Shooting >> Beautiful Charisma Model Affair Video Leaked Former J ● Exclusive Big Tits Model Cum Inside In A Secret Meeting With A Big Day Big P

  • amateur censoredcreampiebig titsfrinfrin-044frin044480frin-044
    • 2021-08-07
    137 min

    [CEAD-356]I Am A Pleasure Fanatic Of A Lewd Masturbator, No. 18. Mei Satsuki.

  • satsuki mei censoredsquirtingmature womanCEADserebu no tomoCEAD-356CEAD356cead00356
    • 2021-08-11
    61 min

    230OREC-851 Rina

  • amateur censoredcreampieamateurorecorec-851orec851230orec-851
    • 2021-08-30
    65 min

    SIRO-4611 [First Shot] [Beautiful Lady] [Bombing] A Married Woman Who Is An Active Teacher Who Has A Former Student As A Saffle Appears. Every Time The Big Ass That Is A Complex Is Struck, It Undulates And Culminates Many Times .. AV Application On T

  • amateur censoredmarried womanamateursirosiro-4611siro4611siro-4611
    • 2021-09-11
    150 min

    [NASH-570]My Girlfriend Is In Her 50s. My Girlfriend Is In Her Fifties I"m Over Fifty, Do You Really Want To Be With Me？ Fuck Me？ 4 Mature Women Sex Buddies In Their 50s

  • censoredcreampiebig titsNASHpinkshigeru haganadeshikoNASH-570NASH570nash00570
    • 2021-09-23
    124 min

    [HAVD-1012]Kissing All The Time! Can"t Stop Cumming! Dirty Lesbian Sex Who Love Each Over A Lot

  • waka ninomiya nagatsuki natsuki censoredlesbianHAVDhibinodr torihamaHAVD-1012HAVD10121havd01012
    • 2021-09-24
    50 min

    FC2PPV 2122291 [Personal Shooting] Massive Launch To Slender Beauty Big Tits Dirty Slut Fumie!

  • amateur uncensoredfc2
    • 2021-10-01
    176 min

    [CAWD-297]A Super Skilled Cunt Who Has Inherited Her Mother"s DNA! A Little Devil Thoroughbred Erect Nipple Bitch In Uniform Who Smiles As She Toys With Men Until They Achieve Complete Satisfaction Aya Izumi

  • aya izumi censoredbig titsslutCAWDkawaiiusapyonCAWD-297CAWD297cawd00297
    • 2021-10-15
    99 min

    277DCV-192 Is It Okay To Send It Home？ Case.186 [* Be Careful Of Eardrum Explosion! Gasping Voice Max! It’s Too Masochistic And Full Of Highlights Sp] ⇒ Strangling Iki, Nipple Iki, Iramaiki, Just Sweaty And Crazy Iki! Gakuburudo M Makai! ⇒ Perfe

  • amateur censoredsquirtingamateurdcvdcv-192dcv192277dcv-192
    • 2021-10-16
    140 min

    [GMEM-047]ULTRA SWEET Check Out Those Red Bearded Clams A Young Lady Descends Into A Hell Of Infinite Orgasms - Hear Her Crazy Pussy Scream As Her Untainted Cunt Is Soiled With Powerful Orgasms - Sachiko

  • sachiko censoredbig titssingle workGMEMavsbaba za babiiavscollector s goldGMEM-047GMEM047gmem00047



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download