sports girls




FC2MIAASSNIGVHJUFEAUKSKSBJRBDHMNSSISHNDHDKAFSDSSDTTDASDMEYDAVSAAMBIEBODVENUSAN

2018-08-03
240 min

[FIV-021]5 Star ch Picking Up Sporty Girls SP ch.21 Lose Yourself In 4 Hours Of Sexy Sporty Bodies!

  • censoredbig titsamateurFIVprestigefive starsFIV-021FIV021118fiv00021
    • 2018-06-27
    480 min

    [FSTE-014]Barely Legal Sports Teens, 8 Hours: Sweat Glistening on 23 Girls with Healthy Toned Bodies

  • censoredbeautiful girlFSTEfirst starsummaryFSTE-014FSTE014h-491fste00014
    • 2018-04-13
    200 min

    [SABA-399]Picking Up Girls And Finding Sporty Schoolgirls A Beautiful Girl Who Has Dedicated Her Youth To Sports Is Busy In Shameful Masturbation & Sweaty Pussy Creampie Raw Footage

  • censoredcreampiebeautiful girlSABAclass s amateurplanetSABA-399SABA399h-244saba00399
    • 2017-09-08
    121 min

    [SUPA-231]Picking Up Girls For Instant Sex Miss A (Age 22) A Sports Instructor

  • censoredcreampieamateurSUPAs kyuu shiroutok tarouSUPA-231SUPA231h-244supa00231
    • 2017-06-10
    119 min

    [MISM-058]A Hot And Beautiful Athlete With A Tight Body And A 54cm Small Waist, And A Big Ass, Is A Pure And Anal Drunker

  • censoredanalMISMm girls labsuisei akaiMISM-058MISM058mism00058
    • 2017-02-16
    201 min

    [NHDTA-948]Sports Gym Humiliation Occupation ~ Girls Getting Raped And Can't Resist Orgasming ~

  • censoredNHDTAnatural highjaken kodamaNHDTA-948NHDTA9481nhdta00948
    • 2015-07-21
    236 min

    [ULT-064]Picking Up Girls On The Way From From The Gym! ~I've Got Protein That's Great For Your Post-Workout!~

  • censoredamateurULTprestigeultraULT-064ULT064118ult00064
    • 2015-07-10
    233 min

    [ULT-062]Picking Up Girls On Their Way Home From School Sports! ~Smell Their Adolescent Scent~

  • censoredschoolgirlamateurULTprestigeultraULT-062ULT062118ult00062
    • 2014-09-06
    174 min

    [IENE-459]I'm So Unpopular With Girls That My Schoolmate Took Pity On Me Enough To Let Me Rub My Cock On Her Thighs. I Promised Her It Wouldn't Go Any Further, And My Dick Slipped Right In! It Felt So Good I Couldn't Stop If I Wanted To A

  • censoredcreampieschoolgirlIENEie nergykiku rinIENE-459IENE4591iene00459
    • 2014-08-21
    125 min

    [IENE-453]The Girls' Sports Club Members Must Be Totally Obedient To Their Seniors! The Senior Who Is A Lesbian Targets A Naive Junior And Gives Her A Crash Course In Lesbianism In The Corner Of The Field Under The Pretense Of Extra Training Afte

  • censoredlesbianIENEienergyie nergyIENE-453IENE4531iene00453



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download