she




FC2AMBIRBDBBANSHKDJULAPODWAAASSISBLKROYDMARANACRGMEMADNSANAWDCESDHMNVEMASQTE

2020-04-26
30 min

[HHKL-028]Is She Exposing Her Nipples On Purpose？ This Horny Woman Came Shopping at the Convenience Store Without Wearing a Bra! Turns Out She Was a Slut Looking For a Quickie!

  • censoredcreampieHHKLhunterkoichi davidsonhhh groupHHKL-028HHKL028hhkl00028
    • 2020-04-26
    142 min

    [SQTE-297]Honest Girl Hikaru-chan Has A Cute Smile And If You Tease Her She'll Beg You To Let Her Cum. Hikaru Takashiro

  • hikaru takashiro censoredbeautiful girlsingle workSQTEs cuteno directorSQTE-297SQTE297sqte00297
    • 2020-04-26
    132 min

    [KTKL-078]"The Irrumatio Man" One Day, My Mother Brought A New Man To Our House, And She Told Me, "This Is My New Husband" And From That Day Forward, We All Lived Together. Huh, Is This The End Of The World？ For Me, It Was The Beginni

  • censoredcreampieamateurKTKLkitixx mousouzokuloliconKTKL-078KTKL078ktkl00078
    • 2020-04-25
    180 min

    [MIRD-202]Polygamy 2 She Hates Middle-Aged Men, But Now She's In The Middle Of A Creampie Harem! Kaho Imai Kurea Hasumi Tsubasa Hachino

  • natsuho imai hasumi claire censoredcreampiebig titsMIRDmoodyztrendy yamaguchimoodyz realMIRD-202MIRD202mird00202
    • 2020-04-25
    120 min

    [MIAA-269]She Twists His Sensitive Cock Just As He's About To Cum, And Gets Sticky-Fingered In Multiple Orgasmic Action! This Maid Loves To Lick Cocks, And She Sure Knows How To Clean Rei Kuruki

  • satoshi kuruki censoredblowjobbeautiful girlMIAAmoodyzgoemoneveryone s porn starMIAA-269MIAA269miaa00269
    • 2020-04-25
    122 min

    [ITSR-079]This Old Lady Is Getting Serious. At First She Laughed Pleasantly, "Please Don't Tease Me!" But Then The Mood Turned Real And Sexy!？ In The End, Even Though She Was An Old Lady, Was She Really Going To Put Out For Creampie Sex!？

  • censoredcreampieamateurITSRbig morkalmaxitadakiITSR-079ITSR07957itsr00079
    • 2020-04-24
    118 min

    [DAVK-054]When This Plain Nurse Strips, She Reveals Her Amazing Colossal I-Cup Tits And Super Slim Body [Outdoor Climax From Only Tits And Nipples] [Consecutive Titty Fucking With Massive Dripping Cum] 7P Orgy Endless Sex All Deep Kiss Quickies [Hard

  • censoredbig titsDAVKtmatakashi hashidadoujin av clubDAVK-054DAVK05455davk00054
    • 2020-04-24
    316 min

    [SCPX-391]Forbidden Sex With My Sweet Older Step-Sister: Giving Her A Raw Creampie So She Might Get Pregnant - 12 Girls, 5 Hours Special

  • censoredcreampiebig titsSCPXscoopno directormousouzokuSCPX-391SCPX391h-565scpx00391
    • 2020-04-23
    202 min

    [PIYO-071]I Wasn't Supposed To Lay A Hand On This Chick, But She Took A Love Potion, And Wound Up Having Relentless Irrumatio With My Monstrous Cock. And Then... 4 (4)

  • censoredsquirtingschoolgirlPIYOhyokopiero dagrey wolfPIYO-071PIYO0711piyo00071
    • 2020-04-23
    120 min

    [FSDSS-030]She's Already Cum But Her Hips Won't Stop Moving: Older Girl Riding Cowgirl Reverse Piston Piledriver Fuck Ayaka Tomoda

  • ayaka tomoda censoredcreampieslutFSDSSfalenofaleno starFSDSS-030FSDSS0301fsdss00030
    • 2020-04-23
    150 min

    [IENF-077]She's Not Hiding Her Pussy Behind Her Hands Or Her Fingers, So You Can Get A Good Look At Her Poking Her Cunt, In And Out! She'll Hit You With Dirty Talk While She Pleasures Herself With An Egg Vibrator Stick Masturbation Session 4

  • rui hizuki mihina azumihina mihina nagai censoredIENFienergyno directorieneIENF-077IENF0771ienf00077
    • 2020-04-23
    119 min

    [IORA-003]She's Been Ranked No.1 For 17 Straight Months And Maintained Her Position On The Throne Because She's A Genuine Legendary Soapland Princess, And Now, She's About To Finally Unveil Herself... A High-Class Mature Woman Soapland Pr

  • ichika aso censoredcreampiemature womanIORAcenter villagedaichi minamizegu center villageIORA-003IORA003h-086iora00003
    • 2020-04-23
    121 min

    [HBAD-534]Fakecest In This Family, The Father Lusts Openly After His Stepdaughter When She Comes Of Age, And Proceeds To Stick His Cock In Her Hikaru Harukaze

  • spring breeze censoredsingle workHBADhibinonamitaro umababeHBAD-534HBAD5341hbad00534
    • 2020-04-23
    111 min

    [MILK-085]Look How High She Goes! Lolita Fucking In the Air 3 Kotone Toa

  • toua kotone censoredcreampiesquirtingMILKmilkMILK-085MILK085h-1240milk00085
    • 2020-04-23
    447 min

    [NHDTB-396]She Was Getting Her Pussy Deep Fucked Inside The Futon With Hard And Tight Piston-Pounding Thrusts, And She Couldn't Cry With Pleasure Or Her Husband Would Hear, So This Sensual Wife Kept On Cumming Back For More 4 Cums With Highlights

  • censoredcreampieNHDTBnatural highbacon tanakaNHDTB-396NHDTB3961nhdtb00396
    • 2020-04-23
    120 min

    [SW-699]Not Only Does She Have Big Tits, She Never Wears A Bra, So Her Titties Are Jiggling And Wiggling And I Can See Them And I Can't Take My Mind Off Of It, And She's Wearing Knee-High Socks And That Total Domain Of Eroticism Is So Allurin

  • censoredbig titsSWswitchswitch switchSW-699SW6991sw00699
    • 2020-04-23
    121 min

    [GS-328]When I Arrived Home, I Found My Friend's Girlfriend There At My Front Door, With Her Panties Exposed!？ It Seems That She Got Into A Fight With Her Boyfriend, And Ran Out Of The House. Since The Only Thing I Could Do Was Invite Her Inside,

  • censoredGSsosoru x garconred ballGS-328GS3281gs00328
    • 2020-04-23
    129 min

    [MOND-188]Unusual Days of a Married Woman: She's Requested Sexual Caretaking Reiko Kobayakawa

  • kobayakawa reiko censoredmature womansingle workMONDtakara eizohotate ikkandaiichi housouMOND-188MOND18818mond00188
    • 2020-04-23
    105 min

    [SPRD-1276]Step-mother Creampie! She Gets Creampied by Her Step-son for the First Time! Sayuki Izuki

  • sayuri itsuki censoredcreampiemature womanSPRDtakara eizokyuta tukumoaleddinSPRD-1276SPRD127618sprd01276
    • 2020-04-21
    105 min

    [SDJS-062]She Likes It Rough, Asumi Yoshioka

  • yoshioka asuka censoredbig titssingle workSDJSsod createinoue japansod female employeeSDJS-062SDJS0621sdjs00062
    • 2020-04-21
    65 min

    SIRO-4153 [First Shot] [Pure Naive Daughter] [Soft Milk Fucking] F Cup Soft Milk 20 Years Old. She Said "I Don’T Know How Good Sex Is .." .. AV Application On The Net → AV Experience Shooting 1242

  • amateur censoredbig titsamateursirosiro-4153siro4153siro-4153
    • 2020-04-21
    140 min

    [MSFH-013]She'll Use Her H-Cup Tits And Her Ultra Sensual Body To Serve You Some Cum Crazy Hospitality... An Ultra High Class Members-Only Soapland That's So Popular You Can Never Get A Reservation Madoka Shizuki

  • madoka shizuki censoredbig titssingle workMSFHsod createzaku araims sodMSFH-013MSFH0131msfh00013
    • 2020-04-21
    120 min

    [STARS-231]So Now You're Finally Ready To Fuck... She Knew Him Ever Since She Was A C***d, But One Day, Suddenly, She Got Fucked... Maria Wakui

  • maria wakui censoredschoolgirlsingle workSTARSsod createk westsod starSTARS-231STARS2311stars00231
    • 2020-04-20
    138 min

    [ANZD-004]This Former Nurse Wanted To Be An AV Star. She Looks Cute, But Wound Up Being A Totally Perverted, Insatiable Sex Freak! Ai

  • censoredbig titsamateurANZDanzu daydream vacationanzuANZD-004ANZD004anzd00004
    • 2020-04-20
    240 min

    [TKBN-013]She Looks Like The Neat And Clean Type, But This Girl Loves Freaky Sex 240 Minutes

  • censoredamateurblowjobTKBNstar paradisetreasure shipTKBN-013TKBN013h-254tkbn00013
    • 2020-04-20
    117 min

    [NSPS-892]She Can't Tell Her Husband About Her Perverted Desires - She Wants To Get Fucked Hard

  • takeuchi maya shiroyama wakana censoredmature womandramaNSPSnagae stylejotaro tomiNSPS-892NSPS892nsps00892
    • 2020-04-20
    118 min

    [GENS-017]Rough Sex Reversal! - She Picked Up A Younger Guy, But He Took Charge! - Nagisa Kataoka

  • kataoka nagisa censoredmature womansingle workGENSgenekiyoshiGENS-017GENS017gens00017
    • 2020-04-20
    128 min

    [AGAV-020]Woman Owns A Masochist Man She Found Online, Natsuki Kisaragi

  • natsuki kisaragi censoredslutsingle workAGAVsex agent daydreamersminimal iwamurasex agentAGAV-020AGAV020agav00020
    • 2020-04-19
    120 min

    [HND-822]3 Seconds Before She Confesses Her Love - She Gets Fucked Hard By A Guy With A Huge Cock! - Hinata Koizumi

  • hinata koizumi censoredbig titsblowjobHNDbookhiroaHND-822HND822hnd00822
    • 2020-04-19
    150 min

    [NNPJ-385]Miko Is A 21 Year Old Girl Who Sleeps With Guys For Money And Hates Older Men. She Never Expected That This Middle Aged Guy's Techniques Would Make Her Cum Until She Squirted! Her Pride Was Shattered! See Her Degrading, Gushing Orgasms!

  • censoredcreampiesquirtingNNPJnanpa japanNNPJ-385NNPJ385nnpj00385
    • 2020-04-19
    124 min

    [DASD-668]My Neighbor Fucked My Girlfriend - She Fell For The Charms Of An Older Guy - Kanon Ichikawa

  • kanon ichikawa censoredcreampiebeautiful girlDASDdasrokusaburo mishimaDASD-668DASD668dasd00668
    • 2020-04-19
    152 min

    [CAWD-077]She Played Innocent, But When I Fucked Her Things Got Bizarre! Saki, A 20 Year Old College Girl Doing Part-Time Work At A Wellness Center, Is No Longer Satisfied With Regular Sex, And Wants To Do AV

  • censoredbeautiful girlhandjobCAWDkawaiikyoseiCAWD-077CAWD077cawd00077
    • 2020-04-19
    176 min

    [REXD-324]Woman Alone In A Tent! She's About To Lose It... And Can't Resist

  • censoredcreampieamateurREXDredno directormanji groupREXD-324REXD324rexd00324
    • 2020-04-19
    153 min

    [MISM-173]Hot Masochist Discover, Unmatched Beauty Indoors Girl Makes Porn Debut That Would Shock Everyone She Knows

  • censoreddeepthroatbdsmMISMm girls labinaballMISM-173MISM173mism00173
    • 2020-04-19
    148 min

    [NNPJ-384]This Girl Was No Good At Talking And Couldn't Deal With Men, So She Decided To Star In AV To Get Over It. Watch Her Fuck And Swallow Ten Loads

  • censoredamateurblowjobNNPJnanpa japanNNPJ-384NNPJ384nnpj00384
    • 2020-04-19
    234 min

    [REXD-325]Persuasion! Bondage! Rough Sex! - She Gets Down On All Fours And Shows Off Her Ass In Her Job-Hunting Suit!

  • censoredcreampieamateurREXDredno directormanji groupREXD-325REXD325rexd00325
    • 2020-04-17
    240 min

    [MBM-159]"That's Not Why I Came Here..." At Least, That's What She Said... Her Eyes Went Aflutter When She Saw My Macho Body (Something Her Husband Could Never Achieve), In A Creampie Wife Swap Fuck Fest 12 Super-Select Beautiful Marr

  • censoredcreampieamateurMBMprestigembmMBM-159MBM159118mbm00159
    • 2020-04-17
    119 min

    [TIKB-076](Sexy Body Warning) Girl With Huge Tits And Ass Loses Her Mind As She's Plowed By Thick Cock!

  • censoredbig titsTIKBtikitiki.comerTIKB-076TIKB076tikb00076
    • 2020-04-17
    98 min

    [VENU-925]Every Time Her Son-In-Law Cums Inside Her. She Licks Him Clean, Gives Him A Raging Erection, And Takes His Cock Again. Their Forbidden Sex Won't End Until His Balls Are Dry! Yumiko Sakura

  • yumiko sakura censoredcreampieblowjobVENUvenuskaniefakecest winntersVENU-925VENU925venu00925
    • 2020-04-17
    117 min

    [TIKB-077][Smokin' Hot Gal] An Erotic Body That Will Make Your Cock Rock Hard In Seconds! She Pops A Magic Pill Into Your Mouth That Makes Your Cock Swell, And Her Face Contorts With Pleasure As She Loses Herself And Cums Again And Again!

  • censoredbig titsTIKBtikitiki.comerTIKB-077TIKB077tikb00077
    • 2020-04-17
    229 min

    [SIM-070]We Fed Aphrodisiacs To A Swimsuit Model During A Photo Shoot And Made Her Cum Until She Cried! - We Fuck Her Hard And Deep And Cum Inside Her Tight Pussy! 2

  • censoredcreampiebig titsSIMprestigeamateur pussiesSIM-070SIM070118sim00070
    • 2020-04-15
    133 min

    [GVH-060]I Will Obey Your Every Command... I Will Listen To Anything You Say... She's Going Through A Breaking In Experience To Awaken Her Most Perverse Desires Hono Wakamiya

  • honoka wakamiya censoredbig titsbdsmGVHglory questGVH-060GVH06013gvh00060
    • 2020-04-15
    142 min

    [JMTY-025]Lewd Married Woman Arisa Nishimura: She Has A Cute Face But A Big Bush!!! Housewife With Unbelievable Impression Gap

  • nishimura arisa censoredsingle workJMTYteacher mousouzokuissei ukyoJMTY-025JMTY025jmty00025
    • 2020-04-15
    239 min

    [PYM-336]She Mounts It For A Cowgirl Piston Fuck - Squeezing Dildo Masturbation

  • censoredPYMprimoPYM-336PYM336h-283pym00336
    • 2020-04-13
    34 min

    FC2PPV 1334957 [Personal Shooting] A 26-Year-Old Young Wife Who Asked For A Stick Of Another Person To Confirm That She Was A Woman In Front Of Her Wife

  • amateur uncensoredfc2
    • 2020-04-12
    114 min

    [NSPS-888]She Got Fucked And Impregnated By Her Husband's Boss - Kei Mimori

  • kei mimori censoredmature womansingle workNSPSnagae stylenagaeNSPS-888NSPS888nsps00888
    • 2020-04-12
    130 min

    [DVAJ-450]His Dick Is Ready To Explode, And She's Slowly Grinding On Him, Teasing Him, And Then Hitting Him With Some High-Speed Piston-Pounding Action To Bring Him Within An Inch Of Ejaculation As She Shifts Gears Into A Cowgirl A 3-Fuck Cum-Spl

  • hasumi claire censoredcreampiebig titsDVAJalice japannanzaki masakiDVAJ-450DVAJ450dvaj00450
    • 2020-04-12
    155 min

    [USAG-011]"My Goal Is To Fuck 10,000 Men!" In Any Case, All She Wants To Do Is Try Out Some New Cocks, Because She's A Super Slut College Girl She's Losing The Orgasm Battle To Consecutive Piston-Pounding Cocks!

  • censoredcreampieamateurUSAGrabbit daydreamersUSAG-011USAG011usag00011



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download