santa




FC2VENUMIDEKSBJSSISSDABNACXDASDHNDWAAAMEYDDASDMIDVHDKAGVHNGODJULBBANHUNTBSSNIVENX

2020-12-01
243 min

[ZMAR-030]The Works! Chitose Yura

  • yuri chitose censoredcreampiebig titsZMARplanet plusthe whole damn thingZMAR-030ZMAR030h-237zmar00030
    • 2020-12-01
    140 min

    [KIRE-012]A Thirty-Something Woman Can Raise Her Value Through Sex. Sumire Kurusu 30 Years Old Her Adult Video Debut

  • sumire kurusu censoredblowjobsingle workKIREsod createdainanabeauty kirei sodKIRE-012KIRE0121kire00012
    • 2020-12-05
    160 min

    [PRED-272]Even If You Untie Her, She Still Shakes That Ass! She Really Gets Off Riding And Climaxing Boys Who Don't Know How To Thrust Yuki Takeuchi

  • yuki takeuchi censoredcreampieslutPREDpremiumtrendy yamaguchielegancePRED-272PRED272pred00272
    • 2020-12-17
    235 min

    [HUNTA-915]"If You Want To Do Naughty Stuff You Can Use My Body However You Like. It'll Be Good Practice For Me Too..." Still A Cherry Boy, I Get To Use My Younger Step-Sister's Body For Sex Practice! Lil Sis Just Keeps Getting Cuter.

  • censoredcreampieschoolgirlHUNTAhuntermorikihhh groupHUNTA-915HUNTA915hunta00915
    • 2020-12-21
    84 min

    [GREDB-1020]Private Sex/Mirai Takahashi

  • censoredbig titsbeautiful girlGREDBintec incGREDB-1020GREDB1020h-706gredb01020
    • 2020-12-25
    243 min

    [MGT-130]Picking Up Amateur Girls On The Street Corner! Vol.97 Convincing Beautiful Married Women For Real. 8

  • censoredcreampieamateurMGTprestigemegatraMGT-130MGT130118mgt00130
    • 2021-01-01
    126 min

    [PETS-001]I Crossdress After School (Private Footage) Super Cute Guy In Drag Kurione Hikyo

  • ice asahi crione censoredcosplaysingle workPETSpetshop daydream tribePETS-001PETS001pets00001
    • 2021-01-05
    207 min

    [STARS-316]Compliant Hot Springs Trip - Hikari Aozora

  • hikari aozora censoredsingle workSTARSsod createsuisei akaisod starSTARS-316STARS3161stars00316
    • 2021-01-07
    78 min

    [REBD-521]Nene: Okinawa Romance Detective - Nene Yoshitaka

  • nine yoshitaka censoredsingle workREBDrebeccacimaREBD-521REBD521h-346rebd00521
    • 2021-01-08
    181 min

    [PIYO-098]I Want To Live Off Your Womb - Ever Since I Was Young I Knew I Wanted To Be A Gynecologist. Now I Finally Have My Very First Patient, A Y********l Who's Everything I Hope She Would Be, And Now I Get To Explore Her Inside And Out.

  • censoredcreampieschoolgirlPIYOhyokopiero dagrey wolfPIYO-098PIYO0981piyo00098
    • 2021-01-08
    209 min

    [NHDTB-479]Drool Dripping Down! Pussy Juices Gushing! Passionate Lesbian Cunnilingus With A S********l 2

  • censoredschoolgirllesbianNHDTBnatural highvanilla sakuraiNHDTB-479NHDTB4791nhdtb00479
    • 2021-01-15
    127 min

    [YMDD-218]Beautiful Hostess At A Hot Spring Hotel Lavishes Your Whole Body With Her Tongue - Creampie Sex Included Yu Shinoda

  • shinoda yu censoredcreampiebig titsYMDDmomotaro video publishinghimrockyoung peachYMDD-218YMDD218ymdd00218
    • 2021-01-15
    136 min

    [AEG-011]S&M: Throat Destruction Sara Kagami

  • kagami sara censoreddeepthroatbdsmAEGprestigefamaegean prestigeAEG-011AEG011118aeg00011
    • 2021-01-16
    119 min

    [PPPD-896]I Started Dating My First Girlfriend, But The Big Tits Elder Sister Type Babe Who Lives Next Door Got A Hold Of Me And Now I Can No Longer Get An Erection Unless I See Some Big Tits Hitomi

  • hitomi censoredcreampiebig titsPPPDoppaiPPPD-896PPPD896pppd00896
    • 2021-01-22
    72 min

    FC2PPV 1654786 [Major company model] Leaked ● Hard raw acme SEX at a secret cosplay photo session. A narrow pussy is opened with a thick cock and acme died in a few minutes. Forced seeding as it is (leaked Gonzo data)

  • amateur uncensoredfc2
    • 2021-01-23
    59 min

    FC2PPV 1656538 ☆ Limited number, final discount! ☆ The coming-of-age ceremony has been canceled and all schedules are awesome! Misa is a beautiful girl who earns pocket money by having sex with her hungry man. Creampie! Cleaning cum! [Multiple benefi

  • amateur uncensoredfc2
    • 2021-02-09
    54 min

    FC2PPV 1657587 [Personal shooting] A large amount of raw squirrels are fired at Sachiko, a slender and slender mature woman!

  • amateur uncensoredfc2
    • 2021-02-13
    30 min

    H4610 ki210213 Self Shot

  • amateur uncensoredh4610
    • 2021-02-20
    46 min

    H4610 ori1749 Ikumi Yagawa 20years old

  • amateur uncensoredh4610
    • 2021-03-03
    46 min

    362SCOH-044 [Creampie] Let a carefully selected beautiful girl cosplay and conceive my child! [Pi ● Kio]

  • amateur censoredcreampieamateurscohscoh-044scoh044362scoh-044
    • 2021-03-04
    41 min

    FC2PPV 1711472 Gonzo with a 44-year-old wife who sells underwear Nasty wife who makes her body jerk [with high image quality]

  • amateur uncensoredfc2
    • 2021-03-05
    122 min

    [UMD-771]Partied Out Married Women 3: When Her Husband Is Out... You Get Horny When You Party, Don't You, Mrs.？

  • nene tanaka kanon kanon censoredbig titsUMDleodragon nishikawaUMD-771UMD771125umd00771
    • 2021-03-11
    118 min

    [NEO-755]A Simple Woman - China Chikusa

  • chigusa china censoreddeepthroatsingle workNEOradixshio sakurabaneo radixNEO-755NEO755433neo00755
    • 2021-04-02
    160 min

    [JUL-522]Electric Transfer! Honoka Yonekura Madonna Only Debut! Beautiful Older Woman Loses Herself In A New Pleasure 3 Times

  • hoika yonekura censoredmature womanslutJULmadonnamametaro mamezawaJUL-522JUL522jul00522
    • 2021-04-14
    125 min

    [ARM-971]Urara Kanon's All-POV Masturbation Support - She'll Turn You On With Her Jungle Bush!

  • hanaoto urara censoredanalsingle workARMaroma planningmania satoshiaromaARM-971ARM971arm00971
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-01
    190 min

    [HUNTA-998]I'm The Only Boy At This School, And When It's Time To Do The Massive School Cleanup, I'm In Panty Shot Heaven! Everywhere I Look, All I See Are Endless Panty Shot Opportunities And That's Got Me Super Excited! Up Until Las

  • censoredcreampieblowjobHUNTAhunterkonjac kanohhh groupHUNTA-998HUNTA998hunta00998
    • 2021-05-06
    50 min

    10musume 050621_01 A Call Girl With Ramu-chan Cosplay Riko Sawamura

  • amateur uncensored10musume
    • 2021-05-14
    47 min

    285ENDX-342 A Female College Student With Cute Dimples! If you take it off, fair-skinned big tits will not stop masturbating with the desire to kiss a lot!

  • amateur censoredcreampieamateurendxendx-342endx342285endx-342
    • 2021-05-14
    240 min

    [HUNTB-013]I'm Together With My C***dhood Friend, And We're Playing A Private Game Of Truth Or Dare! We Always Liked Each Other, But Because We Were Always Together, We Could Never Tell Each Other That, And So We Continued With This Weird Rel

  • censoredschoolgirlHUNTBhunterkawajirihhh groupHUNTB-013HUNTB013huntb00013
    • 2021-06-11
    140 min

    [EBOD-829]My Girlfriend's Big Tits - I Couldn't Resist The Temptation Of Whispered Dirty Talk From A Knock-Out Babe And Ended Up Giving Her My Creampie. Mina Kitano

  • mina kitano censoredcreampiebig titsEBODe bodyrokusaburo mishimaEBOD-829EBOD829ebod00829
    • 2021-06-17
    69 min

    200GANA-2506 Seriously Nampa, first shot. 1649 Pretending to be a neat music college student who aspires to be a music teacher and picking up! Although I am confused by the erotic story, if I give a flickering reward, I will be swept away and open my

  • amateur censoredbig titsamateurganagana-2506gana2506200gana-2506
    • 2021-06-17
    118 min

    [DDOB-094]Tongue-Twisting Shame Witness The Scream Of The Deep Throat Anaconda Yumi Saeki

  • yuka saeki censoredcreampiemature womanDDOBdogmatenunmy auntDDOB-094DDOB094ddob00094
    • 2021-07-02
    104 min

    [ADN-328]Sweaty Noon Fucking With A Sexually Frustrated Married Woman - Tsumugi Akesato

  • akari tsumugi censoredsingle workADNattackersnaotootona no dramaADN-328ADN328adn00328
    • 2021-07-02
    156 min

    [JUL-627]From A Young Talent To A Beautiful Wife Promising Amateur Madonna Exclusive Debut Ema Kishi 28 Years Old Porn Debut

  • ema kishi censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-627JUL627jul00627
    • 2021-07-14
    152 min

    [BLK-504]kira kira Exclusive SPECIAL! We Bring You Hyper Gal Babe Maria Nagai.

  • maria nagai censoredbig titsslutBLKkira kirasamoarikira kira black galBLK-504BLK504blk00504
    • 2021-07-16
    62 min

    444KING-044 Reiko

  • amateur censoredcreampiebig titskingking-044king044444king-044
    • 2021-07-21
    87 min

    435MFC-125 [Sexual Beast Metamorphosis Bunny] If You Don’T H, You’Ll Die! ？？ Beautiful Busty Body With Strong Libido Pyon-Chan Is Here! Jumping At The Woman On Top Posture While Being Alive ♪ 2nd Round Of Vaginal Cum Shot With Raw Saddle So

  • amateur censoredcreampiebig titsmfcmfc-125mfc125435mfc-125
    • 2021-07-26
    50 min

    285ENDX-355 I’M So Embarrassed But Bottomless And Sensitive JD

  • amateur censoredcreampieamateurendxendx-355endx355285endx-355
    • 2021-08-10
    44 min

    FC2PPV 1980808 [Individual Shooting] Prefectural General Course ③ A Girl Who Is Forced To Have Sexual Intercourse With A Stranger By A Classmate And Is Groped By An Uncle And Drips White Love Juice.

  • amateur uncensoredfc2
    • 2021-08-13
    165 min

    [BANK-050]The Coed Gal Hot Spring Resort A Cheerful Horny Elder Sister Type With A Shaved Pussy And J-Cup Big Tits Who Loves To Do Sexy Things

  • censoredcreampiebig titsBANKma ko ginkoutakechanBANK-050BANK050h-1495bank00050
    • 2021-08-13
    70 min

    518ASGM-015 [Daddy Live JK / Intravaginal Ejaculation] Famous Lady School Jk (Private / Regular Course / Back Op) D Cup

  • amateur censoredcreampieamateurasgmasgm-015asgm015518asgm-015
    • 2021-08-14
    103 min

    [VEC-491]Wife Betrayed By Friend Gets Creampied By Scum, Michiru Kujo

  • kujo michiru censoredcreampiemature womanVECvenuspe tamegami venusVEC-491VEC491vec00491
    • 2021-09-09
    180 min

    [NHDTB-576]"I Need Your Dick In My Ass And Pussy Please..." Remote Dildo For Long Distance Anal Play Pleasure! Sports Girl Loves Getting Her Two Holes Filled For Maximum Pleasure Down Below!

  • censoredNHDTBnatural highxylonocaineNHDTB-576NHDTB5761nhdtb00576
    • 2021-09-24
    102 min

    [YSN-560]I Am Raising A Girl Who Is Famously Cute In The Neighborhood. Mitsuki Nagisa

  • scooping censoredcreampiedeepthroatYSNnonYSN-560YSN560h-127ysn00560
    • 2021-10-02
    140 min

    [PKPD-164]H Cup Chubby Cosmetologist Fuck Buddy Misono Is Healing And So Cute, Misono Mizuhara

  • suwon miso censoredcreampiebig titsPKPDpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPD-164PKPD164pkpd00164
    • 2021-10-23
    240 min

    [NANX-237]She Seems Like A Bitch, But Is She Actually Slutty!？ Quickie Picking Up Girls All Raw Creampies 12 Women 4 Hours

  • censoredcreampiebig titsNANXk m producenanpa heavenNANX-237NANX237nanx00237
    • 2021-11-10
    94 min

    435MFC-157 [100,000 Followers! !! Forbidden Raw Vaginal Cum Shot Sex Of Underground Idol And Preparatory School Instructor] Cum Shot Twice In Total To Unprocessed Horny Hair Ma ○ Ko That Can Not Be Imagined From Too Cute Features! !! [Shiroto Gonzo ＃

  • amateur censoredcreampieamateurmfcmfc-157mfc157435mfc-157



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download