outdoors




FC2SPRDWAAAMEYDHDKADASDSTARSPPPDGVHSSNIKBISDABVENXMIDVATIDMIDEAMBISANSHKDVEMACJOD

2020-09-21
171 min

[TCD-260]Natural Sub Crossdresser's Total Obedience - Lovely Cum Dumpster Izumi Morino

  • izumi morino censoredsingle workbukkakeTCDtrans clubTCD-260TCD260tcd00260
    • 2020-10-02
    69 min

    [NTTR-052]Possessed Cutter @Beauty Salon Part 1 - Yuri Asada

  • yuri fukada censoredcreampiebig titsNTTRsod createmiura lefttakeoverNTTR-052NTTR0521nttr00052
    • 2020-10-02
    63 min

    [KBTV-026]We Heard That This College Girl Was Secretly The Neighborhood Cum Dumpster, But Is It True？ We Find Out!

  • censoredamateurblowjobKBTVgoing too far tvKBTV-026KBTV026h-1514kbtv00026
    • 2020-10-03
    477 min

    [OFJE-282]My Girlfriend Is Yura Kano And She's Getting Continuously Fucked By A Piece Of Shit In This Melancholy Erection NTR 8-Hour Selection You'll Be Certain To Be Emotionally Engaged And Sympathetic With What Happens In This Full Length D

  • yura kanno censoreduniformbeautiful girlOFJEs1 no 1 styleOFJE-282OFJE282ofje00282
    • 2020-10-10
    183 min

    [MIAA-326]My Girlfriend's Bestie Whispered Dirty Talk Into My Ear Until I Was Ready To Blow Then Took My Creampie Nozomi Ishihara

  • ishihara hope censoredcreampieslutMIAAmoodyznao masakieveryone s porn starMIAA-326MIAA326miaa00326
    • 2020-10-11
    81 min

    200GANA-2366 Seriously flexible, first shot. 1538 Successful pick-up of a beautiful woman who is kind to a goddess! When you hit her with an electric massager, which is called skinship and will be washed away if you shorten the distance, her facial e

  • amateur censoredamateurganagana-2366gana2366200gana-2366
    • 2020-10-16
    147 min

    [HZGD-167]A Week Without My Husband...The Stepdad I Hate Continued To Have Fun With Me And Gave Me A Creampie Yuka Hoshi

  • yuka hoshi censoredcreampiebig titsHZGDmarried woman flower garden theaterhirokoji osakiimageHZGD-167HZGD167h-1100hzgd00167
    • 2020-10-20
    133 min

    [MSFH-031]A C***dhood Friend Who Manages My Ejaculations, Since Even Though I'm Already Engaged I Can Barely Control My Sexual Desires - Madoka Shizuki

  • madoka shizuki censoredbig titsslutMSFHsod createkaorums sodMSFH-031MSFH0311msfh00031
    • 2020-10-22
    65 min

    336KNB-125 It’s really de M! A pitiful wife who is asked for S by her SEX partner because of her cool appearance! Being led and attacked strongly, exposing your true self and getting sweaty and disturbed! I will take a gonzo with this married wo

  • amateur censoredmarried womanamateurknbknb-125knb125336knb-125
    • 2020-10-24
    63 min

    FC2PPV 1544828 [Completely hidden shooting] No outflow! With a small camera installed, the whole story of vaginal cum shot from raw squirrel negotiations is released to a business trip Menes beauty older sister

  • amateur uncensoredfc2
    • 2020-10-24
    119 min

    [JUL-351]My Mom's Friend - Rin Ogawa

  • rin okae censoredbig titsmature womanJULmadonnajyoji kawaiJUL-351JUL351jul00351
    • 2020-11-02
    77 min

    [SHIBP-063]コイビトホシイ/遠藤あさみ

  • asami endo censoredanalsingle workSHIBPshibuya promotionSHIBP-063SHIBP063h-1235shibp00063
    • 2020-11-04
    60 min

    345SIMM-545 Mai / 18 years old / Neat and clean girls who writhe with remote control ● Raw

  • amateur censoredcreampieuniformsimmsimm-545simm545345simm-545
    • 2020-11-13
    151 min

    [MIDE-849]Gaping Wide Deep Throat Face Fucks - Slut Tied Up And Skewered By Cock To Incredible Creampie Orgasms Tsubomi

  • bud censoredcreampiedeepthroatMIDEmoodyzsuisei akaimoodyz divaMIDE-849MIDE849mide00849
    • 2020-11-13
    140 min

    [ZMEN-069]When I Was Left Alone With My Colleague, Who Got Soaked In A Sudden Thunderstorm...

  • minami saya rina kikuchi censoredZMENz mengoro koenjiZMEN-069ZMEN069h-1371zmen00069
    • 2020-12-04
    60 min

    [PARATHD-3048]Will The Massage Girls At Business Hotels Get You Off？ (8) - Nonomiya's Tits Are So Huge She's Bursting Out Of Her Uniform

  • censoredbig titsuniformPARATHDparadise tvPARATHD-3048PARATHD3048parathd03048
    • 2020-12-09
    59 min

    [CSDX-008](4K) Cosplay x Narumi Hirose Narumi Hirose

  • narumi hirose censoredcreampiecosplayCSDXcrystal picturecosdeluxeCSDX-008CSDX00849csdx00008
    • 2020-12-10
    62 min

    [orex-178]せなちゃん 2

  • amateur censoredcreampieschoolgirlorexorex-178orex178orex-178
    • 2020-12-11
    28 min

    FC2PPV 1602238 [No] I made a cute junior college student cosplay as a cat and made two big cock men commit

  • amateur uncensoredfc2
    • 2020-12-11
    47 min

    [NTTR-057]The Possessed Idiot Tensions Are Explosively High!!!!! It's 200 Million Percent Fucked Up LOL We're Busting Girls And Boys And Convenience Stores!!!!! The Extreme Second Part Mitsuki Nagisa

  • scooping censoredNTTRsod createota migiwaknotriNTTR-057NTTR0571nttr00057
    • 2020-12-24
    38 min

    FC2PPV 1618084 Erotic Santa Bombing with delight to wear open legs! It hangs down and makes a vulgar noise and firmly to the back of the throat. There is a bonus video ♪ [Personal shooting]

  • amateur uncensoredfc2
    • 2021-01-15
    47 min

    FC2PPV 1645865 [Personal shooting] Ginza club mom raises funds to protect the store Enko! Raw insertion cum shot in glamorous big ass

  • amateur uncensoredfc2
    • 2021-01-26
    53 min

    FC2PPV 1660371 ★ First shot amateur ☆ Intense big ass ♥ Gonzo with a sexy married woman Naomi 31 years old ☆ Powerful SEX like a foreigner ♥ Rolling up lust for other sticks ♥ Plenty of vaginal cum shot at the end ♥ [Personal shooting] * With benefit

  • amateur uncensoredfc2
    • 2021-01-27
    167 min

    [GAID-015]DM Smartphone Immediate Shooting: Super Rare Live Production Shibuya-Omiya-Ikebukuro - S********ls Only Smartphone Vertically Shot POV Video

  • censoredcreampiebig titsGAIDfirst staraida first starGAID-015GAID015h-491gaid00015
    • 2021-01-28
    56 min

    345SIMM-599 Gonzo roll up while parents are sleeping with beautiful breasts erotic ass sister × 2 times cum shot

  • amateur censoredcreampieuniformsimmsimm-599simm599345simm-599
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-03-18
    220 min

    [HUNTA-971]"Please Untie Me ... This Is So Embarrassing" I Tied Up My C***dhood Friend In Special Knots That Are Impossible To Untie By Herself, And I Put Her In The Paradise Lock Position, And When I Saw Her Thrusting Her Super Erotic Ass Ou

  • censoredschoolgirlHUNTAhuntergorilla butahhh groupHUNTA-971HUNTA971hunta00971
    • 2021-04-05
    113 min

    [SIS-125]Elder Sister Night Visit Creampie Peeping R**e

  • censoredcreampiesisterSISglay zsisterSIS-125SIS12512sis00125
    • 2021-04-08
    144 min

    [IESP-679]Asuka Momose - First Time Lesbian - I Fell In Love With My Cousin

  • momose asuka rumi tadami censoredschoolgirllesbianIESPienergykikuriniespIESP-679IESP6791iesp00679
    • 2021-04-09
    420 min

    GWGANA-001 [Limited time sale] [MGS exclusive distribution BEST] Nampa TV Vol.01 Golden Selection 26 people 420 minutes

  • amateur censoredamateurgwganagwgana-001gwgana001gwgana-001
    • 2021-04-10
    73 min

    200GANA-2460 Seriously Nampa, first shot. 1619 Persuade an intelligent woman to pick up a dropped book! Seriously, an experienced real estate lady is disturbed in a suit!

  • amateur censoredbig titssquirtingganagana-2460gana2460200gana-2460
    • 2021-04-21
    55 min

    492JCHA-014 The first denma is a lie

  • amateur censoreduniformschoolgirljchajcha-014jcha014492jcha-014
    • 2021-04-27
    61 min

    499NDH-014 [Gal signboard girl in Shinjuku underground bar. ] Perfect body underground bar gal clerk persuaded and cum shot SEX! Although it looks flashy, the contents are clever and the gap difference is erotic! Spread your proud legs and poke them

  • amateur censoredcreampieamateurndhndh-014ndh014499ndh-014
    • 2021-04-28
    173 min

    496SKIV-010 Naochan 2 (21)

  • amateur censoredcreampieamateurskivskiv-010skiv010496skiv-010
    • 2021-05-19
    133 min

    [GVH-236]Confinement Tied Up Gal Anal Rough Sex - Alice Toyonaka

  • alice toyonaka censoredanalsingle workGVHglory questchintaGVH-236GVH23613gvh00236
    • 2021-05-20
    20 min

    HEYZO 2529 Yu’s Orgasms with Toys – Yu Sakuma

  • yu sakuma uncensoredblowjobheyzo
    • 2021-06-26
    67 min

    SIRO-4528 [First shot] [Geki Kawa rookie OL] [Fair-skinned beautiful breasts] A large rookie from the sales department who drops a man with a cute face that leaves a young child participates in the war. She holds her finger and fascinates her serious

  • amateur censoredamateursirosiro-4528siro4528siro-4528
    • 2021-06-29
    47 min

    FC2PPV 1893598 ♪♪ Excavation ♪♪ Mai-chan 25 years old Super cute fair-skinned H-cup large amount of breast milk mom and breast milk play-in-mouth firing ※※ with benefits ※※

  • amateur uncensoredfc2
    • 2021-06-29
    52 min

    396BIG-109 Aimi

  • amateur censoredcreampieschoolgirlbigbig-109big109396big-109
    • 2021-07-03
    151 min

    [URKK-041]Live-In Lifestyle With My I-Cup Step-Cousins: The Temptation Of Their Colossal Tits - Titty Fucks, Dual Creampie

  • tomoko kamisaka yukino nagi censoredbig titssisterURKKunfinishedrolanda familiar breastURKK-041URKK041urkk00041
    • 2021-07-10
    120 min

    [GMA-021]Wife Bondage Training. A Happy Married Life Collapses as the Wife is Consumed by the Wild and Mad Pleasures of Ropes. Mao Hamasaki

  • hamazaki mao censoredmature womanbdsmGMAglobal media annexkikujiro akabaneGMA-021GMA021gma00021
    • 2021-07-17
    119 min

    [NNPJ-462]A Tokyo Halo Girl. Fucking A Girl in an Overwhelmingly Cute Uniform. Beautiful Girl With a Cute Animal Personality & Perfect Grade Blowjob 3 Raw Blasts Suzu-chan

  • censoredcreampieuniformNNPJnanpa japanNNPJ-462NNPJ462nnpj00462
    • 2021-07-22
    120 min

    [JJDA-020]Squeezing My Teacher's Huge Tits For Good Luck Hana Haruna

  • haruna hana censoredcreampiebig titsJJDAmature woman college real mature womanmanji groupJJDA-020JJDA020jjda00020
    • 2021-07-24
    54 min

    [DANDAN-006]"This Old Lady Can't Wait..." The Sensual Therapist In A Legit Massage Parlor That Invites A Boner. Her Secret Option That Leaves You Breathless. Miss Mina ( 30 Years Old) I Cups.

  • censoredbig titshandjobDANDANdandytanaka baconDANDAN-006DANDAN0061dandan00006
    • 2021-08-06
    153 min

    [MEYD-692]The Cool Beauty Is Really A Pervert. An Ex-Model Who"s Weak To Being Pushed. Houswife AV Debut Ayu Takita

  • ayu takita censoredsquirtingsingle workMEYDtameike gorotake dMEYD-692MEYD692meyd00692
    • 2021-08-06
    61 min

    10musume 080721_01 With My Friend: Let’S Do Threesome With 2 Hot Girls Yu Nagata Sakie Hayasaka

  • amateur uncensored10musume
    • 2021-08-07
    135 min

    [AVSA-176]An Oil Massage She Was Massaged With Aphrodisiac-Laced Oils, Which Transformed Her Into A Horny Slut, And Now She Was Receiving A Secret Optional Course Of Anal Massage Pleasure!! Ai Sato

  • airi sato censoredanalbig titsAVSAavsariari sanpeiavscollectorsAVSA-176AVSA176avsa00176
    • 2021-08-10
    98 min

    FC2PPV 1979403 It Was Ridiculous! Wait For A While. Immediately Delete Your Body! [No Individual Shooting, Darkness Route No. 6. Honor Student Lady, Outflow] The Darkness Of A Beautiful Girl With A Loli Face … The Settlement That Can Not Be Said

  • amateur uncensoredfc2



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download