outdoor fuck




FC2EBODHNDAUKGPREDNGODHUNTBBLKCHRVHMNSHKDAVSASSNISPRDWAAAAWDNNPJMVSDAUKGSQTENACR

2020-09-24
126 min

[JRZD-993]Entering The Biz at 50! Yoshie Kashiwagi

  • yoshie kashiwagi censoredcreampiemature womanJRZDcenter villageminatoyashoku ureJRZD-993JRZD993h-086jrzd00993
    • 2020-09-26
    66 min

    1Pondo 092620_001 A woman who seduces a man with her chest Miyu Ono

  • amateur uncensored1pondo
    • 2020-09-28
    54 min

    [DHT-170]Reiko Kobayakawa Will Gently And Relentlessly Make You Cum A Cherry Boy Popping Documentary

  • censoredbig titsmature womanDHThot entertainmentkazuki madokaDHT-170DHT17059dht00170
    • 2020-10-18
    52 min

    S-Cute 790_yuina_02 Facial cumshot SEX / Yuina to a beautiful woman who blows tide and spree

  • yuina censoredamateuryuinayuina-02yuina02790-yuina-02
    • 2020-10-19
    16 min

    FC2PPV 1539808 ☆ First shot ☆ Complete appearance ☆ Curious & curious 20-year-old beautiful girl who has been eating for the first time Gonzo ♥ Even if it is said that it is useless, I can not stand it and cum shot! Hey, get angry …？ ？？ [Wit

  • amateur uncensoredfc2
    • 2020-11-20
    96 min

    [VNDS-3350]A Stepmom Finds Her Stepson Jerking Off To Her Underwear, So She Sucks His Cock For Him 2

  • kyoka kahara anka kahara soko censoredblowjobmature womanVNDSstar paradisenext toilet r eVNDS-3350VNDS3350h-254vnds03350
    • 2020-11-27
    59 min

    Caribbeancom 112720-001 The Work For New Employee Vol.23 Kana Takashima

  • kana takashima uncensoredcreampiehandjobcaribbeancom
    • 2020-11-27
    120 min

    [NEM-048]New Kinky Sex 2 - MILF In Her Fifties Craves Her Stepson's Cock Iku Kondo

  • satoshi kondo satomi kondo censoredbig titsmature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-048NEM048143nem00048
    • 2020-11-27
    99 min

    [SHMO-177]"I'm Cumming With My Girlfriend! A Lovey-Dovey Coed Bathing Hot Spring Resort Date!"

  • amateur censoredSHMOorustak softSHMO-177SHMO177
    • 2020-12-08
    487 min

    [MUCH-118]Super Heavyweight! Super Bouncy BOX 8 Hours, 4-disc Set

  • megumi okamoto aoi kuroki censoredbig titsMUCHmothermuchi mutchiMUCH-118MUCH118h-796much00118
    • 2020-12-13
    139 min

    [MIBM-005]Plump Asses And Swimsuit Competition - Ami Kashiwagi

  • ami kashiwagi censoredMIBMmillmil silverMIBM-005MIBM005mibm00005
    • 2020-12-17
    210 min

    [HUNTA-916]I Was Hanging Out At Home With Several Of My College Buddies. But The Girl I Liked Not Only Wasn't Interested In Me, But She Was On The Verge Of Dating This Other Guy!？ So I Decided To Pay Her A Night Visit In The Dead Of Night.

  • censoredblowjobHUNTAhunterkawajirihhh groupHUNTA-916HUNTA916hunta00916
    • 2020-12-26
    74 min

    [ssan-014]つばさサン

  • amateur censoredbig titsamateurssanssan-014ssan014ssan-014
    • 2020-12-31
    41 min

    FC2PPV 1627201 [Personal shooting] A married woman of a life insurance lady who burns in a bad act! Cheating wife who shakes a beautiful naked body and faints in agony at the woman on top posture [Creampie]

  • amateur uncensoredfc2
    • 2020-12-31
    116 min

    [NKKD-189]Red-Hot Dripping And Sweaty NTR A Wife And A Young S*****t Adultery Sex In A Cramped Apartment Reiko Kobayakawa

  • kobayakawa reiko censoredbig titsmature womanNKKDjet eizomanji groupNKKD-189NKKD189nkkd00189
    • 2021-01-03
    61 min

    10musume 010421_01 With My Friend: Play Red light, Green light With Adult Toy Yu Nagata Haruna Kawai

  • amateur uncensored10musume
    • 2021-01-20
    98 min

    300MIUM-671 [Can you tear off your nipples？ ] Unexpectedly pigmented adult nipples of an unfussy office lady who works for telework in a girly room are pulled around and played with, and the unbearable man who works from home shines in the sunshine.

  • amateur censoredbig titsamateurmiummium-671mium671300mium-671
    • 2021-01-22
    66 min

    [orex-195]えりな 2

  • amateur censoredcreampieamateurorexorex-195orex195orex-195
    • 2021-01-29
    61 min

    328HMDN-332 [Married Woman 3P / Aphrodisiac Oil] 6 Weekly Nasty Wife With Cheating Cock 30 Years Old I Was Squid By An Unequaled Cock On An Affair Hot Spring Trip And Completely Fallen In 1 Hour. A big cock is screwed into a shaved pussy and a white-

  • amateur censoredcreampiebig titshmdnhmdn-332hmdn332328hmdn-332
    • 2021-02-01
    143 min

    [DROP-055]Amateur Girls Who Got Hard When Their Nipples Were Tweaked 3

  • censoredbig titsamateurDROPoffice k sDROP-055DROP05536drop00055
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-15
    65 min

    SIRO-4424 [First shot] [F cup active JD] [Smile → Dirty face contrast] An active female college student with an atmosphere that seems to be good for men. The foolery that a popular woman shows to the camera for the first time is .. Application amateu

  • amateur censoredbig titsamateursirosiro-4424siro4424siro-4424
    • 2021-03-03
    73 min

    326EVA-144 Drink a guarantee at the pool pick-up immediately Paco ☆ If you switch on, you will not know the ceiling! Suppress Mutsurisukebe, who is weak to push, with the power of gold ww

  • amateur censoredamateurevaeva-144eva144326eva-144
    • 2021-03-06
    147 min

    [BBAN-315]Hana Kanno And Renai Aoi's No-cut Lesbian Series Live

  • kanna flower blue censoredsquirtinglesbianBBANbibianBBAN-315BBAN315bban00315
    • 2021-03-10
    54 min

    475SKCK-027 Rei 2

  • amateur censoredanalamateurskckskck-027skck027475skck-027
    • 2021-03-11
    57 min

    H0930 ki210311 Akiko Tachihara 27years old

  • amateur uncensoredh0930
    • 2021-03-12
    28 min

    FC2PPV 1723125 Up to 15 [Individual] Thirty married woman. Borrowed money to go on to school for my child and failed to pay debts. After mouth licking in the car, the offspring is poured into the raw vagina with another stick

  • amateur uncensoredfc2
    • 2021-03-12
    61 min

    [DPL-008]Amateur Female Karate Figher VS Male Amateur Wrestler And Actor Natsuki Nagahara 22 Years Old

  • nagatsuki natsuki censoredDPLplay entertainmentDPL-008DPL008h-1557dpl00008
    • 2021-03-14
    73 min

    428SUKE-064 [Half Gal x Dance x Sex] Only the black gal won! !! Filipino half pie bread dancer appeared! Trained belly circumference! The waist is erotic! Sex dance regardless of sofa, stairs, location ☆ Party held www [NO.5 Sara]

  • amateur censoredcreampiebig titssukesuke-064suke064428suke-064
    • 2021-03-20
    180 min

    [OFKU-178]The Bride's Mother Was Beautiful And Sexy For A Forty-Something Lady, And Her Son-In-Law Got Hot And Horny For Her Ripened Body And Popped His Cock In Raw 180 Minutes

  • kana suruga fukuyama iroha censoredcreampieblowjobOFKUstar paradisemom railOFKU-178OFKU178h-254ofku00178
    • 2021-03-26
    118 min

    [MIMK-087]Part Time Worker Wife's Lusty Affair ~ Live Action Version ~ Cuckholding Pregnancy Fetish With A Big Titty Big Ass Wife! Yuri Honma

  • really censoredcreampiebig titsMIMKmoodyzdragon nishikawamankitsuMIMK-087MIMK087mimk00087
    • 2021-03-30
    67 min

    492JCHA-066 Guess Scrap and Beautiful Girl 3

  • amateur censoredamateurbeautiful girljchajcha-066jcha066492jcha-066
    • 2021-04-15
    82 min

    [REBD-551]Risa: Colossal Tits Feature: Record Of Nudity - Risa Dan

  • rinsha dan censoredsingle workREBDrebeccachikara sawamuraREBD-551REBD551h-346rebd00551
    • 2021-04-30
    106 min

    483SGK-024 [9 head and body half GAL] [Worldwide god style] [Endless continuous climax] [Kitsuman Saddle tide] [Continuous 3P overwhelming 4 shots] [No longer advance to the world! ？？ ] Gal Suta Gram Global Expansion Worldwide Half-Beauty Lunch Ki Cu

  • amateur censoredbig titssquirtingsgksgk-024sgk024483sgk-024
    • 2021-05-02
    139 min

    [PKPD-141]Pulling Out Mid-Ejaculation After Fucking A Sugar Baby S********l With G-Cup Peach-Like Tits Rimi Momono

  • rimi momono censoredcreampiebig titsPKPDfuck group and fun friends daydreamersPKPD-141PKPD141pkpd00141
    • 2021-05-06
    60 min

    336KNB-153 A lewd young wife "Reika" who has a desire to "want to see SEX by others". Legs while being inserted Pink masturbation is apt! !! I will take a gonzo with this married woman from now on. 46 at Tsudanuma Station, Narashino C

  • amateur censoredmarried womanamateurknbknb-153knb153336knb-153
    • 2021-05-21
    69 min

    491TKWA-173 SEX I-Cup Big Breasts Enko J ● I Just Learned Allows Creampie By Rolling Up Continuously!

  • amateur censoredcreampiebig titstkwatkwa-173tkwa173491tkwa-173
    • 2021-05-21
    118 min

    [CAWD-218]I Had Always Loved Him, And When We Met Again After A Year Apart ... I Was No Longer A Virgin, And I Was Lonely, Living In The City On My Own, And Filled With Despair, But It Was My C***dhood Friend Who Had Cum To Rescue Me ... Youthful Cre

  • satsuki mei censoredcreampiebeautiful girlCAWDkawaiiCAWD-218CAWD218cawd00218
    • 2021-05-30
    78 min

    300NTK-579 Black GAL x Swimsuit x Bitches! !! Dream Black Gal SEX Festival Gangbang 4P Opening! !! Super-dreadnought brown bottle cans Beautiful breasts gal’s squirting squirting Outdoor ascension and the pool is squirting! !! Sexual Defense Eve

  • galp censoredcreampiesquirtingntkntk-579ntk579300ntk-579
    • 2021-06-04
    69 min

    230OREC-779 Natsuko-san

  • amateur censoredbig titsmarried womanorecorec-779orec779230orec-779
    • 2021-06-11
    120 min

    [MUDR-151]My Client Is My Stepdad...!？ This Busty S********l Reaches An Amazing Climax Getting Fucked Doggy Style By Her Stepdad's Cock, For Which She Has Perfect Compatibility - Suino Wakamiya

  • honoka wakamiya censoredcreampiebig titsMUDRinnocentMUDR-151MUDR151mudr00151
    • 2021-06-12
    151 min

    [SCOP-726]This Married Woman Was Carelessly Taking Out The Garbage Without Her Panties And Bra On, And I'm A Cherry Boy. She Knew That I Was Spying On Her, And Then She Started Flashing Her Tits And Pussy At Me On Purpose! And Not Only Did She Fl

  • censoredcreampiebig titsSCOPscoopk taromousouzokuSCOP-726SCOP726scop00726
    • 2021-07-10
    106 min

    [HOKS-099]Me More than Your Wife! The Stepmom's Sensation of Hugging. The Flavor of Ripe Meat.

  • eriko kurata aki misato censoredbig titsmature womanHOKSfa prokinzo ogurokkuHOKS-099HOKS099hoks00099
    • 2021-07-15
    120 min

    [BBTU-017]The Masochist With Shaved Pubes. Chitose Yuki

  • chitose in the evening censoredbig titssingle workBBTUdogmatenunmy big titsBBTU-017BBTU017bbtu00017
    • 2021-07-15
    120 min

    [CMC-258]A Widow with Colossal Tits and Fleshy Buttocks: A Record Book of Incidents Involving Brainwashing Stings. Riko Tokushima.

  • riko tokushima censoredsingle workCMCcinemagicshinichi kawamuracollectCMC-258CMC258cmc00258
    • 2021-07-30
    104 min

    [YST-252]An Amateur Photographer Tries to Imitate Ore-Chin Ends Up Unexpectedly Fucking his Model (Ha!).

  • aimi mao tajima censoredblowjobYSTkoyachoYST-252YST252540yst00252
    • 2021-08-13
    150 min

    [PPPD-956]This Big Tits Girl With J-Cup Titties Used To Work At A Cafe, But Now She"s Become An Adult Video Actress, And Taking On Her First Challenge! A Super Service Fresh Face Soapland Misono Mizuhara

  • suwon miso censoredbig titsbeautiful girlPPPDoppaiPPPD-956PPPD956pppd00956
    • 2021-08-20
    46 min

    HEYZO 2617 Creampie in America #Gabbie5 – Gabbie

  • gabbie uncensoredheyzo



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download