money




FC2SSISJUFESHKDMEYDBBANADNCESDAUKGAPODAUKSCAWDAVSADTTMIDVMARAVEMASPRDHNDGVHLULU

2020-10-04
47 min

FC2PPV 1522853 Personal shooting] A married woman who entrusts her child to her husband and is vaginal cum shot with another stick to repay debt! Libido that has exploded due to stress accumulated by hard work

  • amateur uncensoredfc2
    • 2020-10-21
    83 min

    418YSS-77 Momo

  • amateur censoredsquirtingamateuryssyss-77yss77418yss-77
    • 2020-10-24
    146 min

    [DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-11-05
    485 min

    [ABBA-495]Monthly Center Village Survey Bonus Edition 2020's Highest Ranked MILFs - Greatest Hits - 30 Mature Girls, 8 Hours, 2 Discs

  • censoredcreampiemature womanABBAcenter villageABBA-495ABBA495h-086abba00495
    • 2020-11-13
    99 min

    [VEMA-152]Wet, Twining Tongues With A Naughty Teacher - The Time I French Kissed My Male S*****t When His Parents Weren't Home Yumiko Sakura

  • yumiko sakura censoredcreampieblowjobVEMAvenuspetermegami venusVEMA-152VEMA152vema00152
    • 2020-11-20
    240 min

    [MGDN-141]Lower Halves On Display In The Dressing Room! Pranks On MILF Clerks - 240-Minute Special

  • censoreduniformblowjobMGDNstar paradisemegadonMGDN-141MGDN141h-254mgdn00141
    • 2020-11-22
    122 min

    [HND-918]I Did Not Take A Step Outside my Home During The Lockdown Period... I Gave Some Sloppy Creampies Over And Over Again To My Slutty, Busty Female Senior. Touka Rinne

  • roaring sound censoredcreampiebig titsHNDhon nakamiyoshi rusherHND-918HND918hnd00918
    • 2020-11-22
    49 min

    FC2PPV 1579571 [Individual shooting] Please stop the innocent J system that you can not hide the tension with the first daddy active circle light! While saying that, the dick is an honest erotic girl! Selfishly conceived raw squirrel and vaginal cum

  • amateur uncensoredfc2
    • 2020-11-26
    155 min

    [FSDSS-128]Pussy On The Verge Of Overheating! Hot Springs Trip Orgasms That Won't Subside Yume Nikaido

  • nikaido yume censoredbig titsbeautiful girlFSDSSfalenotequilia tinofaleno starFSDSS-128FSDSS1281fsdss00128
    • 2020-12-10
    131 min

    [MEKO-195]All New "The Old Lady Rental Service" 03 They Say That This Hotly Rumored Home Helper Service Will Provide You With Creampie Sex, So I Started Making More And More Extreme Demands

  • censoredcreampieamateurMEKOmilf laboMEKO-195MEKO195h-1160meko00195
    • 2020-12-14
    23 min

    FC2PPV 1606646 ☆ Complete appearance ☆ Beautiful girl similar to a former gravure idol again ♥ Service to the master ♥ Rich vaginal cum shot with maid cosplay SEX ♪ [with ZIP]

  • amateur uncensoredfc2
    • 2021-01-01
    130 min

    [ABW-042]All-Natural Pussy Juice- 120 Pure - 69 - Hard Sex Pushes The Limits Of Female Flesh

  • nagisa konomi censoredanalbig titsABWprestigecharlie nakataabsolutely wonderfulABW-042ABW042118abw00042
    • 2021-01-15
    201 min

    [SABA-672]Full Service With a Married Woman!! Erotic Oil Massage

  • censoredbig titsSABAskyu shirotohasshiSABA-672SABA672h-244saba00672
    • 2021-01-15
    254 min

    [SKMJ-141]Magna Cum Laude - Top-Scoring College Girl's First-Ever Masturbation Appreciation Session! ASMR-Style Close-Up Whispering And Sounds - Fap-Fap - Rock Hard Rod Makes Her Pussy Clench With Anticipation! "I Can't Take It Anymore...

  • censoredcreampiebig titsSKMJblush girlyosukeSKMJ-141SKMJ141h-1324skmj00141
    • 2021-02-05
    55 min

    396BIG-072 Yumina (31)

  • amateur censoredcreampiebig titsbigbig-072big072396big-072
    • 2021-02-05
    131 min

    [HODV-21549]Pleasure Syndrome Case 6: "A Baby-faced Masochistic Woman Who Keeps Crying As She Cums Over And Over Again" - Chiharu Miyazawa

  • chiharu miyazawa censoreddeepthroatsingle workHODVh m pHODV-21549HODV215495642hodv21549
    • 2021-02-05
    122 min

    [UMD-765]A Husband-And-Wife-Swapping-Hot-Spring-Resort-Vacation 10 A Perverted And Beautiful Married Woman With Cuckold Fantasies Is Wishing For Night Visit Plays!! What!？ The Other Wife Is A Pervert Too!？

  • kanon kanon ayaka muto censoredmature womanUMDleodragon nishikawaUMD-765UMD765125umd00765
    • 2021-02-11
    175 min

    [SW-757]I Hooked Up With My Girlfriend Because She's Got Big Tits, Is Shy, And Not Too Smart, So When Her Busty Buddy Showed Up, I Suggested A Threesome.

  • censoredbig titsSWswitchcambridgeSW-757SW7571sw00757
    • 2021-02-11
    115 min

    [FSDSS-172]Impatiently Begging: Super Horny Sex - Moe Tenshi

  • angel moe censoredblowjobsingle workFSDSSfalenoyamaguchi memberfaleno starFSDSS-172FSDSS1721fsdss00172
    • 2021-02-17
    50 min

    444KING-029 Hina

  • amateur censoredcreampiebig titskingking-029king029444king-029
    • 2021-02-22
    136 min

    [ANZD-068]172cm Tall Stylish Serious Girl With Long Beautiful Legs Goes Cum-Crazy To The Point Of Forgetting Herself - Seri-chan

  • censoredamateurANZDanzu daydream vacationanzuANZD-068ANZD068anzd00068
    • 2021-03-05
    37 min

    [BTH-124]If You Cum On My Face My Husband Will Find Out...Please Try To Get It In My Mouth Miku Aoki

  • misaki aoki censoredmarried womanbukkakeBTHchobitchchovicBTH-124BTH124h-1435bth00124
    • 2021-03-06
    240 min

    [DVDMS-640]A Normal Boys And Girls Focus Group Adult Video A Thorough Investigation Of The Lust Of An Amateur College S*****t If They Can Resist Having Sex Until The Break Of A Dawn, They'll Win 100,000 Yen! After Missing Their Last Train Home, T

  • censoredcreampieamateurDVDMSdeepsdeep sDVDMS-640DVDMS640dvdms00640
    • 2021-03-13
    119 min

    [NSPS-975]I Wanted To Test My Wife's Love For Me - I Followed Her To Her Class Reunion, And I Witnessed A Never-Ending Stream Of Horrors - Miho Aikawa

  • miho aikawa censoredmature womansingle workNSPSnagae stylejotaro tomiNSPS-975NSPS975nsps00975
    • 2021-03-30
    53 min

    509JPAK-005 Private smartphone Gonzo! All you want to do with Geki Kawa uniform [Personal shooting]

  • amateur censoredcreampieuniformjpakjpak-005jpak005509jpak-005
    • 2021-03-31
    57 min

    292MY-454 Honda Minami 2

  • amateur censoredcreampiemarried womanmymy-454my454292my-454
    • 2021-04-02
    133 min

    [JUL-526]Married Office Lady Shows Off Her Stocking Thighs Fucking The Shameful Boss's Wife Kana Mito

  • kana mito censoredmature womansingle workJULmadonnajotaro tomiJUL-526JUL526jul00526
    • 2021-04-02
    125 min

    [ARM-967]This Sexy Maid Will Help Her Master With His Masturbation.

  • misaki azusa mamiya nagi censoredanalARMaroma planningmania satoshiaromaARM-967ARM967arm00967
    • 2021-04-13
    53 min

    Pacopacomama 041321_459 Cum On Tits: Ayane Yuuki, Fumina Tomaru, Madoka Ayakawa

  • amateur uncensoredpacopacomama
    • 2021-04-15
    169 min

    [SORA-308]Sex Camp Plump Slut Gets Extra Turned On When She's Outside! Chie Aragaki

  • tomoe aragaki censoredbig titsSORAyama to sorahimu lockSORA-308SORA308sora00308
    • 2021-04-15
    120 min

    [KSBJ-131]A Newly-married Stepniece Tempted By Her Stepuncle - Sachiko

  • sachiko censoredcreampiebig titsKSBJksb kikaku emmanuellebito sakuraKSBJ-131KSBJ131ksbj00131
    • 2021-04-18
    240 min

    [SCOP-718]We Heard There Were Call Girls Who Would Get Horny If You Put A Vibrator Near Their Pussy, But What Actually Happened When We Tried Was Even Wilder! You'll Never Imagine What Happened Next! 240-Minute Complete BEST Collection

  • censoredcreampiebig titsSCOPscooptaro kSCOP-718SCOP718scop00718
    • 2021-05-06
    64 min

    SIRO-4476 [First shot] [Slender sensitive body] [Superb dirty gal] A slender gal goddess with infinite libido descends. The instinct bare SEX of the erotic goddess who repeats ascension many times faithfully to her desire is a must-see. AV applicatio

  • amateur censoredamateursirosiro-4476siro4476siro-4476
    • 2021-05-15
    45 min

    481SACZ-025 Setsuko 1

  • amateur censoredamateurmature womansaczsacz-025sacz025481sacz-025
    • 2021-05-20
    120 min

    [DLDSS-007]Personal Trainer Seduces Client With Her Thick Beautiful Ass And Has Full-Body Sweaty Sex Tina Nanami

  • nanami tina censoredsingle workDLDSSdahliayamaguchi memberDLDSS-007DLDSS0071dldss00007
    • 2021-05-22
    214 min

    [CEAD-340]Pleasure Masturbation Festival! Motionless Body Cums And Climaxes! Wriggling Slutty Bodies 14 Selections!

  • yui hatano otsuki sound censoredsquirtingmature womanCEADceleb no tomoCEAD-340CEAD340cead00340
    • 2021-06-17
    78 min

    [REBD-567]Umi: Light Blue Platonic/Umi Yakake

  • yakake umi censoredsingle workREBDrebeccachikara sawamuraREBD-567REBD567h-346rebd00567
    • 2021-06-20
    240 min

    [MKMP-404]SUPER COMPLETE BEST Aoi Kururugi

  • aoi kururugi censoredcreampiebeautiful girlMKMPkm producetaro kmillionMKMP-404MKMP404mkmp00404
    • 2021-06-24
    210 min

    [SW-782]My Female Colleagues Seduce Me By Showing Off Their Panties Through Their Black Pantyhose In The Office And On Business Trips - Do You Mind If I Rip Your Stockings And Stick My Dick In？

  • censoredSWswitchyocchanswitch hibinoSW-782SW7821sw00782
    • 2021-06-25
    72 min

    FC2PPV 1887779 ＃ 65 Natsu: Smile, personality, gestures, all too cute. Creampie aiming for a safe day for TV personalities. [Personal shooting] [Gonzo] [High image quality]

  • amateur uncensoredfc2
    • 2021-06-25
    47 min

    FC2PPV 1886293 [No] [Complete appearance] 22-year-old Faculty of Law Ai-chan Appearance that violates the law for money Conceived by a beautiful law student and vaginal cum shot [* Blow (mouth ejaculation) & undressing / shower hidden shooting ben

  • amateur uncensoredfc2
    • 2021-06-26
    97 min

    [VENX-051]A Stepson Became A Practice Dummy For His Stepmom Who Decided To Work At A Soapland - Rio Ohara

  • osamu osamu censoredcreampiebig titsVENXvenuskaniefakecest winntersVENX-051VENX051venx00051
    • 2021-07-09
    182 min

    [UMD-788]That's A Real Climax Face!! I Make That Face When I Cum SP 3

  • ayaka mochizuki mitani akari censoredsquirtingUMDleotabu osakiUMD-788UMD788125umd00788
    • 2021-07-10
    142 min

    [USAG-032]Remi-chan (23) Dark Gyaru/Cuckold/NTR/Big Ass/Facial Cumshot/Creampie/3 Cock Group Sex/POV/Threesome

  • censoredbig titsUSAGrabbit daydreamersUSAG-032USAG032usag00032
    • 2021-08-17
    68 min

    FC2PPV 2036258 [No] [Complete Appearance] 20-Year-Old Faculty Of Literature Neat And Clean Beautiful Girl Yuki-Chan ＃ 3 "Put Out A Lot In The Back .. !!" Lovely Vaginal Cum Shot Sex Prepared For Pregnancy [* Cum Swallowing In Ferris Wheel &am

  • amateur uncensoredfc2
    • 2021-08-20
    121 min

    [UDAK-006]"Be on your guard..." I Pranked The Woman Giving Me A Massage

  • censoredcreampieuniformUDAKstar paradiseyudakimoUDAK-006UDAK006h-254udak00006
    • 2021-08-31
    56 min

    292MY-479 Nonomura Miu 1

  • amateur censoredmarried womanamateurmymy-479my479292my-479
    • 2021-09-02
    53 min

    FC2PPV 2129123 [2021/9/30 Completely Deleted] [D.C] My Sister Gal Is Retiring, So I Tried To Release Sex Out In Private. 6th ① Creampie ☓3 [Sayaka-Chan] Completely Retired

  • amateur uncensoredfc2



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download