long hair




FC2ROYDAMBISSNIMILKDTTNACRSPRDWAAANATRMEYDHNDONEZLULUAPODVENUHMNCESDSTARSATIDAUKS

2020-09-26
180 min

[MIFD-131]Fresh Face Dreams Of A 20 Year Old. AV Debut 987 Days After That Day She Decided To Be An AV Actress Hana Shirato

  • white peach censoredsquirtingbeautiful girlMIFDmoodyzusa pyonmoodyz freshMIFD-131MIFD131mifd00131
    • 2020-10-09
    53 min

    [YMDS-006]Amateurs Put Out At The Interview - They Only Came To Talk, But Before They Know It They're Taking A Quickie (25-Year-Old Tsukino) Tsukino Okawa

  • okawa tsukino censoredcreampieamateurYMDSmomotaro eizoasakusa ga jirowakamomoYMDS-006YMDS006ymds00006
    • 2020-10-22

    FC2PPV 1543115 Limited [No] I made an ordinary female college student saffle. Remove the rubber and cum swallow continuous ejaculation (46 minutes)

  • amateur uncensoredfc2
    • 2020-10-24
    118 min

    [JUL-356]Before The Wife Next Door Comes Home... Mio Kimishima

  • kimishima mio censoredbig titsmature womanJULmadonnaamazing meatJUL-356JUL356jul00356
    • 2020-10-30
    16 min

    KSTC-010 Nozomisan

  • amateur censoredamateurbeautiful girlkstckstc-010kstc010kstc-010
    • 2020-11-06
    229 min

    [HUNTA-886]After We Missed Our Last Train Home, I Spent The Night At My Co-Worker's Place. We Had A Farewell Party And When It Ended, Realizing That I Would Not Be Seeing Her At Work Tomorrow, I Could No Longer Resist, And Started To Seduce Her.

  • censoredcreampieHUNTAhunterspace nyanjirohhh groupHUNTA-886HUNTA886hunta00886
    • 2020-11-19
    103 min

    [DDOB-083]Trapped In The Locker Room With A Horny MILF Chisato Shoda

  • shota chisato censoredmature womanslutDDOBdogmanormal kimmy auntDDOB-083DDOB083ddob00083
    • 2020-11-19
    136 min

    [TIKP-051]He's Still Breaking Me In... My Descent Into Life As A Submissive Creampie Sex Doll.

  • censoredcreampiebig titsTIKPtikitiki.comerTIKP-051TIKP051tikp00051
    • 2020-11-19
    237 min

    [HUNTA-893]"Damn Girl How Horny Are You...？!" My Coworker's Normally Not Sexy At All But After A Little Liquor Her Lust Is Off The Charts!

  • censoredcreampieHUNTAhuntercognac kaminohhh groupHUNTA-893HUNTA893hunta00893
    • 2020-11-27
    206 min

    [KBI-047]A Beautiful Married Woman Gives The Ultimate Cherry Popping Fuck She'll Kindly And Gently Cherry Pop A Cherry Boy With Proper Instructions And Love!! Minami Shiratori

  • minami shiratori censoredbig titsmature womanKBIprestigemasarupansakanbiKBI-047KBI047118kbi00047
    • 2020-12-01
    130 min

    [SDDE-637]The Inner Sanctum Room - Welcome To My Very Own Horny Married Woman Apartment House, Yay! -

  • ayano kato yano tsubasa censoredcreampieslutSDDEsod createryo inugamisenzSDDE-637SDDE6371sdde00637
    • 2020-12-11
    261 min

    [BAZX-264]A Sex-Starved Married Woman Awakened Her Sexual Instinct And Used Her Exquisitely Big Tits As A Weapon As She Exploded With Passion And Lust! 2

  • censoredcreampiebig titsBAZXbazookatetBAZX-264BAZX264h-1496bazx00264
    • 2020-12-25
    128 min

    [ECB-143]Loving 2 Shots - Sara Ryuboku

  • uryuki sara censoredblowjobbeautiful girlECBwaap entertainmentkurumi ichinosecobra warpECB-143ECB1432ecb00143
    • 2021-01-01
    269 min

    [VPC-005](Aphrodisiac-Powered Sex With You, A Special Edition) Super Erotic Amateur Private Videos Are Being Leaked For Your Viewing Pleasure 05

  • censoredcreampiebig titsVPCprestigevideo podcastVPC-005VPC005118vpc00005
    • 2021-01-02
    81 min

    [opcyn-142]あめり(29)

  • amateur censoredamateuropcynopcyn-142opcyn142opcyn-142
    • 2021-01-06
    52 min

    [sika-003]あーたん(18)

  • amateur censoreduniformschoolgirlsikasika-003sika003sika-003
    • 2021-01-17
    151 min

    [CHCH-003]Due To Corona This Brothel Babe Is Running A Soapland Right Out Of Her Own Home! - Voluptuous Curves, Incredible Sex SK**ls, And Comfortable, Caring Services Make Her The Talk Of The Town -

  • censoredbig titsamateurCHCHmilk and moms emmanuellemilk and momsCHCH-003CHCH003chch00003
    • 2021-01-17
    31 min

    FC2PPV 1648619 [New] [Until January 24, 1900pt → 1500pt] Gonzo with a 21-year-old erotic nursery teacher! !! The chestnut and the inside are rolled up with an erogenous zone!

  • amateur uncensoredfc2
    • 2021-01-22
    227 min

    [SIM-107]My Sexual Routine Is To Take Home A College Girl And Fuck Her This JD Is Cumming Over Because She Undoubtedly Wants To Fuck, So I Happily Obliged And Filmed It All For Your Viewing Pleasure

  • censoredcreampieSIMprestigeamateur pussiesSIM-107SIM107118sim00107
    • 2021-01-29
    60 min

    [OTIM-055](Online Only) (Daydream POV) No Makeup Morning Sex With Your Loving Girlfriend Aoi Nakajo

  • nakagusuku censoredcreampieblowjobOTIMprestigeonetimeOTIM-055OTIM055118otim00055
    • 2021-02-04
    20 min

    Caribbeancom 020421-001 Sexy Celebrity Encyclopedia: Kurumi Kokoro

  • kurumi kokoro uncensoredcaribbeancom
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-13
    109 min

    240TOKYO-408 Yuuka

  • amateur censoredbig titsamateurtokyotokyo-408tokyo408240tokyo-408
    • 2021-02-20
    121 min

    [EKAI-020]Dear Teacher, You're A Maso Man, Right？ Hana Himesaki

  • himesaki hana censoredbig titsslutEKAIwarp entertainmentk westcobra warpEKAI-020EKAI0202ekai00020
    • 2021-02-26
    52 min

    [ETQR-202](Daydream POV) Creampie Sex With A Beautiful Girl In A Sailor Uniform Shizuku 04

  • censoredcreampieuniformETQRerotic timeETQR-202ETQR202h-1186etqr00202
    • 2021-03-04
    83 min

    FC2PPV 1711056 Menheragokkun Angel Mei-chan and continuous sex

  • amateur uncensoredfc2
    • 2021-03-12
    61 min

    FC2PPV 1723713 [First time limited 1000pt off] 21-year-old bartender who has a hobby of saving ❤️ E cup beautiful breasts ❤️ Good blowjob even though she is a serious girl ❤️ Big labia minora and a piston that penetrates the narrow vagina ❤️ Testicle

  • amateur uncensoredfc2
    • 2021-03-14
    16 min

    10musume 031421_01 Secret Pussy Collection: Yuko Ikeda

  • amateur uncensored10musume
    • 2021-03-26
    182 min

    [MIFD-151]20 Year Old Amateur Ryona Hisaka PORN DEBUT Former Popular C***d Actor Who Appeared In TV Shows And Commercials 10 Years Ago! She's Retired From Acting And Is Now A College S*****t At A Famous School!

  • ryona hisaka censoredbeautiful girlsingle workMIFDmoodyzusa pyonmoodyz freshMIFD-151MIFD151mifd00151
    • 2021-04-24
    33 min

    492JCHA-020 I Want A Woman To talk to me 1

  • amateur censoredbig titsschoolgirljchajcha-020jcha020492jcha-020
    • 2021-04-26

    FC2PPV 1787685 Limited number [Uncensored] Big breasts with anime voice that goes on to specialize in long-sought voice actors. However, what was waiting there was ideal and reality …

  • amateur uncensoredfc2
    • 2021-04-30
    141 min

    [BNST-027]Freaky Families: "Hey Big Bro! Do You Love Me？" While Our Parents Were Away For Three Days My Twin Stepsisters Seduced Me With Their Big Tits

  • first love maina miku censoredbig titssisterBNSTteacher delusion groupkamagramBNST-027BNST027bnst00027
    • 2021-04-30
    83 min

    374IMGN-009 Kozue

  • amateur censoredcreampieamateurimgnimgn-009imgn009374imgn-009
    • 2021-05-19
    129 min

    [GVH-235]Booty-Loving Brat's Naughty Pranks Hikaru Konno / Ameri Hoshi

  • hikaru konno star ameri censoredGVHglory questtsunemori takahashiGVH-235GVH23513gvh00235
    • 2021-05-20
    57 min

    FCP-018 [Delivery only] New "Cho, wait, eh! In a place like this !？" 1 beautiful 3 people

  • amateur censoredamateurbeautiful girlfcpfcp-018fcp018fcp-018
    • 2021-05-30
    62 min

    Caribbeancom 053021-001 Good morning blowjob: this is how I wake him up Kana Takashima

  • kana takashima uncensoredcreampiecaribbeancom
    • 2021-06-16
    120 min

    [SSIS-100]108 Intense Orgasms! 4800 Spasms! 1500 CC's Of Squirted Pussy Juice! Fair-Skinned Barely Legal G-Cup's Erotic Awakening - Her First Orgasm Special Uta Hayano

  • hayano uta censoredbig titssquirtingSSISs1 no 1 styleichigoharaSSIS-100SSIS100ssis00100
    • 2021-06-25
    169 min

    [JUFE-304]Big Titty Slut Takes Control And Talks Dirty From A Position Of Absolute Superiority Ultimate POV Controlled Ejaculation Jack Off Instructions Toka Rinne

  • roaring sound censoredbig titsslutJUFEfitchaida yumenoJUFE-304JUFE304jufe00304
    • 2021-06-27
    239 min

    [ODVHJ-034]Real Wives' Real Orgasms: Dildo Masturbation II

  • censoredbig titsmarried womanODVHJgraffiti japanorgasmODVHJ-034ODVHJ03448odvhj00034
    • 2021-07-22
    242 min

    [NHDTB-557]My Boss' Daughter Pisses Me Off, So I Gave Her Several Days Of Asshole Breaking In Training Until She Begged Me, "Cum Inside My Asshole" And I Obliged Her With Anal Creampie Sex 2

  • censoredcreampieNHDTBnatural highkansukeNHDTB-557NHDTB5571nhdtb00557
    • 2021-07-30
    61 min

    Caribbeancom 073021-001 Licking Woman: Nasty Beauty Slut Sucking Cock With A Smooth Face Miyuki Sakura

  • miyuki sakura uncensoredcreampiehandjobcaribbeancom
    • 2021-08-12
    35 min

    [477GRMR-058]汗だくカップルSEX～エアコンが壊れた猛暑日、業者が来るまでの時間すら待てずに窓を開けたままヤッちゃった♪～

  • amateur censoredbig titsamateurgrmrgrmr-058grmr058477grmr-058
    • 2021-08-20
    154 min

    [HMN-028]Ao-chan"s First Orgasm! Ecstasy While Being Cummed Inside! Starring Aoi Amano

  • ao amano censoredcreampiebig titsHMNhonnakamamezawa mametarouHMN-028HMN028hmn00028
    • 2021-09-10
    156 min

    [IPX-726]A Lucky Lady Who Gives Instant Hard Ons Sucks Cock Once She Is Called The Best Blowjob Giving Girlfriend. "I Want All Of Your Cum In My Mouth" (9 Continuous Oral Cumshots!!) Kana Momonogi

  • kana momonogi censoreduniformblowjobIPXidea pocketkyoseidishIPX-726IPX726ipx00726
    • 2021-09-17
    69 min

    230OREC-878 Non

  • amateur censoredcreampieamateurorecorec-878orec878230orec-878
    • 2021-09-24
    153 min

    [CJOD-310]A Plain Jane Big Tits Babe In Glasses I Went To A Soapland That Offered Unlimited Ejaculations And The Girl Pressed Her Meaty, Voluptuous Body Up Against Me, And Made Me Cum 16 Times Ai Sayama Yuria Yoshine

  • sayama love yoshine yuria censoredcreampiebig titsCJODbimamezawa mametarouchijo hebunCJOD-310CJOD310cjod00310
    • 2021-09-25
    72 min

    H0930 tk0042 Rina Tosano 31years old

  • amateur uncensoredh0930
    • 2021-11-12
    148 min

    [MIDV-005]Aphrodisiac Dick Of Brother-in-law I Hate Is Making Me Sweat And We"re Having Sex. Fumika Nakayama.

  • maki miyashita kaede censoredbig titsmature womanMIDVmoodyzoosaki hirokoujimoodyz divaMIDV-005MIDV00548midv00005



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download