leg




FC2AUKGATIDRBDADNMARAAVSADASDAUKSNACRDASDMILKSQTEMEYDSSNIWAAAIPXROYDNGODAMBICJOD

2019-12-07
137 min

[JUFE-127]Tall Slut Who Totally Looks Down On The Men She Controls With Dirty Talk You're Going To Love Having This Extreme POV Flick Control Your Ejaculation Elle Sato

  • sato l censoredslutsingle workJUFEfitchaida yumenoJUFE-127JUFE127jufe00127
    • 2019-12-06
    240 min

    [FIV-053]5 Star Channel - Erotic Gal Special - 7 Carnivorous Gals Turn Up The Heat And Cum With All Their Might!

  • censoredcreampiebig titsFIVprestigefive starsFIV-053FIV053118fiv00053
    • 2019-12-01
    137 min

    [MGMJ-041]Beautiful Panyhose-Legs In The Kitchen Maya Takeuchi

  • takeuchi maya censoredslutsingle workMGMJmegamibeautiful goddess fetishMGMJ-041MGMJ041mgmj00041
    • 2019-11-24
    138 min

    [DPMI-045]The Madness Of A Fantasy With A Campaign Girl Double-Team Hibiki Otsuki Kana Morisawa

  • otsuki sound kana morisawa kanako iioka censoredDPMImiludopamixDPMI-045DPMI045dpmi00045
    • 2019-11-23
    152 min

    [MIAA-194]A Quickie Fuck Gal Who Gets Old Men Hard With Panty Shot Temptation

  • censoredbeautiful girlMIAAmoodyzhatatai ryoeveryone s porn starMIAA-194MIAA194miaa00194
    • 2019-11-23
    221 min

    [CLUB-595]The Temptation Of Beautiful Legs In Black Pantyhose This Slut Gave Me A Footjob And Rubbed Her Thighs On Me While Wearing Musty Pantyhose Stockings, And Made Me To Ejaculate, Over And Over Again

  • censoredCLUBhentai shinshi clubCLUB-595CLUB595club00595
    • 2019-11-22
    121 min

    [XRW-784]The Stepdaughter She Was Fucked By A Panythose-Loving Father-In-Law And Her Crazy Big Brother-In-Law Kotone Toa

  • toua kotone censoredcreampiebeautiful girlXRWreal workshideki hormonreal real worksXRW-784XRW784172xrw00784
    • 2019-11-20
    120 min

    [ARM-815]Garter Belt Wrapped Thighs x Thigh Fucking 3

  • ichinose love himari ogawa censoredslutARMaroma planningshigeo kadowakiaromaARM-815ARM815arm00815
    • 2019-11-15
    115 min

    [MGMJ-039]The Cult Of Sluts In Boots - Aika Mirei, Erina Akane

  • aika mirei erina censoredanalslutMGMJmegamibeautiful goddess fetishMGMJ-039MGMJ039mgmj00039
    • 2019-11-15
    148 min

    [TIKP-039]A Beautiful Married Woman With An Incredibly Erotic Body - Iroha Maeda

  • maeda iroha censoredcreampiebig titsTIKPtikitiki.comerTIKP-039TIKP039tikp00039
    • 2019-11-15
    42 min

    [SHYN-067]Incredibly Massive Squirting! "The Legendary Floods Of The Squirting Princess" An SOD Female Staffer Tuber She Was Suddenly Fucked To Review Sex Toys She's In Her Third Year In The Finance Department Sayo Kunimitsu

  • yayoi kunimitsu censoredsquirtingsingle workSHYNsod createy 10432sod female employeeSHYN-067SHYN0671shyn00067
    • 2019-11-15
    114 min

    [EVIS-284]Pantyhose, Boots, And Foot Fetish Lesbians

  • koharu chihiro suzuki censoredslutEVISebisusan mousouzokucherry tomiyamaEVIS-284EVIS284evis00284
    • 2019-11-14
    120 min

    [SSNI-621]Her Legs Measure 88cm From Her Crotch To The Floor A Barely Legal Babe With Beautiful Legs The Temptation Of A High-Cut Uniform Arina Hashimoto

  • there is hashimoto censoredsquirtinguniformSSNIs one number one stylekyouseis1 no 1 styleSSNI-621SSNI621ssni00621
    • 2019-11-14
    210 min

    [SSNI-618]Total Domain A Voluptuous Thighs In Uniform Peek-A-Boo Show A Bare-Legged Idol In The Ultimate Temptation A Little Devil Beautiful Girl In Knee-High Socks Yua Mikami

  • yua mikami censoredbig titssingle workSSNIs one number one stylebungo maedas1 no 1 styleSSNI-618SSNI618ssni00618
    • 2019-11-10
    221 min

    [CEAD-275]Black Pantyhose, Beautiful Legs, Passionate Sex

  • yui hatano otsuki sound censoredcreampiemature womanCEADceleb no tomoCEAD-275CEAD275cead00275
    • 2019-11-08
    122 min

    [VRTM-463]These Sales Ladies In Black Pantyhose Bow Their Heads To Apologize, Leaving Their Big Asses Vulnerable! - They Get Fucked And Creampied To Hell And Back!

  • ririka nanako miyamura censoredcreampieVRTMv r produceyoshida oliveVRTM-463VRTM463h-910vrtm00463
    • 2019-11-07
    184 min

    [NHDTB-338]Panties Drenched As Molesters Bring Women With Beautiful Legs To Orgasm By Fingering Them Inside Their Pantyhose 3

  • censoredsquirtingNHDTBnatural highkansukeNHDTB-338NHDTB3381nhdtb00338
    • 2019-11-03
    150 min

    [KTB-026]I've Got Pants Too! - Bukkake - OL Suits Club 15 - College Girl Intern Kanon-san Shows Off Her Favorite Miniskirt And A Sexy Pant Suit - Kanon Nakajou

  • nakajo canon censoredsingle workbukkakeKTBkahanshin tigers mousouzokukahanshin tigersKTB-026KTB026ktb00026
    • 2019-11-03
    120 min

    [KCDA-266]Beautiful Legs In A Pantyhose - Perverted Office Lady KCDA- 266

  • censoredbig titsKCDAdigital arkdigital ark digital arkKCDA-266KCDA266kcda00266
    • 2019-11-02
    52 min

    FC2PPV 1192733 [Leotard Paizuri Pinching] 2 Shots Of Paizuri Mass Pinching With Super Naughty High Leg Cut Cos !! Amateur Individual Shooting 042

  • amateur uncensoredfc2
    • 2019-10-27
    110 min

    [EVIS-283]Pantyhose Girl's Arousing Dirty Talk and Masturbation

  • momose yuri aya miyazaki censoredslutEVISebisusan mousouzokugoro koenjiEVIS-283EVIS283evis00283
    • 2019-10-24
    233 min

    [SVDVD-755]The Magic Mirror Number Bus Hard Boiled We Asked Hard-Working Ladies To Wear These Stockings That Sparkle When Wet, So That We Can Get A Good Look At Their Beautiful Legs! And As Things Got More Exciting, We Plied Them With Money For Big D

  • censoredcreampieSVDVDsadistic villagenew kage kazamaSVDVD-755SVDVD7551svdvd00755
    • 2019-10-20
    108 min

    [ARM-806]Miki Sunohara x Tight Miniskirt Thick Ultimate Plan

  • future sunohara censoredcosplaysingle workARMaroma planningshigeo kadowakiaromaARM-806ARM806arm00806
    • 2019-10-13
    138 min

    [TIKB-057]God Specs: I Gave Aphrodisiacs To A 180cm Slender-Legged Super-Stylish Gal And She Let Me Fuck Her Without A Rubber - Elle Sato

  • sato l censoredcreampiesingle workTIKBtikitiki.comerTIKB-057TIKB057tikb00057
    • 2019-10-07
    106 min

    [DPMI-043]Race Queen Lovers Sumire Kurokawa

  • sumire kurokawa censoredsingle workDPMImiludopamixDPMI-043DPMI043dpmi00043
    • 2019-09-28
    116 min

    [JBJB-007]日焼けした純真スポーツ女子はオジさんのザーメン搾り取って大量潮吹きと数えきれない激イキ！ 神谷充希

  • mitsuki kamiya censoredsquirtingsingle workJBJBsharkjabujab townJBJB-007JBJB007h-687jbjb00007
    • 2019-09-24
    21 min

    FC2PPV 1167984 Affair housewife’s sexual confession documentary [Creampie with a pet in Sugi ○ ward office wearing a fluorescent bikini] Creampie with one leg raised standing back "You. The woman working at the ward office was crazy" [Pe

  • amateur uncensoredfc2
    • 2019-09-19
    25 min

    FC2PPV 1164906 [No / Amateur Individual Shooting] Dododo Nasty Girl Appears! Manga cafe without a blow job! If you lick the cock, it will get wet with the pussy, so it’s a leg man! The closed room is sighed with a chupachupa sound and a sigh of

  • amateur uncensoredfc2
    • 2019-09-18
    78 min

    259LUXU-1162 Luxury TV 1157 A beautiful leg dance teacher who has been suffering from sexlessness for 3 years. She licks her tongue unintentionally to the obscenely warped big cock that she sees for the first time in a long time. The pleasure of real

  • amateur censoredamateurluxuluxu-1162luxu1162259luxu-1162
    • 2019-09-14
    191 min

    [GDHH-167]My Stepsister Gives Me A Footjob! My Dad Remarried And Suddenly I Got A Cute Young Stepsister! Not Only That, But She Gives Off A Super Sexy Aura Showing Off Her Bare Legs And Panties...

  • censoredschoolgirlsisterGDHHgolden timekiteretsuhhh groupGDHH-167GDHH167gdhh00167
    • 2019-09-13
    121 min

    [VRTM-453]This Little Brother-In-Law Is Lusting For His Kind And Gentle Big Ass Big Sister-In-Law Who Wears A Tight Skirt! When He Gave Her Aphrodisiacs To Drink She Started Rubbing Her Knee-High Socks Up Against Him And Staining Her Panties, And The

  • otsuki sound yuki sakuragi censoredcreampiesisterVRTMv r producerokutanzo no seishiVRTM-453VRTM453h-910vrtm00453
    • 2019-09-13
    77 min

    [KWP-004]See-through 20 Denier Pantyhose Woman With Hot Legs Saryu Usui

  • sakisui censoredsingle workKWPk westk westpanty fuckingKWP-004KWP004h-1339kwp00004
    • 2019-09-13
    119 min

    [VRTM-450]This Sales Lady Suddenly Came Over, And When She Took Some Aphrodisiacs, She Started Rubbing Her Black Pantyhose Up Against Me, And Dripping With Lust, And Then She Locked Her Legs Around Me And Demanded Creampie Sex! SPECIAL Toka Rinne &am

  • roaring sound anne mashiro censoredcreampieuniformVRTMv r producegoro koenjiVRTM-450VRTM450h-910vrtm00450
    • 2019-09-13
    136 min

    [ZMEN-026]Defenseless Female Boss Taking Off Her Pantyhose Gets Raging Hard Cock From Behind! He Can't Stand It And Cums Right Away! Then Cums Again After They're Back On!! 2

  • risa mochizuki arisa miyagawa censoredZMENz mengoro koenjiZMEN-026ZMEN026h-1371zmen00026
    • 2019-09-09
    129 min

    [BAVC-002]Sexual Gratification Sumire Is Inviting Emotion With Her Plump Butt: Sumire Kurokawa

  • sumire kurokawa censoredsingle workBAVCbaltanspilma boyvictoriaBAVC-002BAVC002bavc00002
    • 2019-09-09
    113 min

    [DPMI-042]Fuck Queen - Maria Nagai

  • maria nagai censoredcreampiesingle workDPMImiludopamixDPMI-042DPMI042dpmi00042
    • 2019-09-08
    118 min

    [ARM-794]Strong Desire For Beautiful Legs: I Want To Finish Off On Your Bare-Skinned Legs

  • kanae lennon sumire kurokawa censoredARMaroma planninghamu oujiaromaARM-794ARM794arm00794
    • 2019-09-06
    485 min

    [TRE-113]Raw Creampie Sex Best Hits Collection Vol.03 When Your Hot Sperm Drips Down The Walls Of Her Pussy, Flowing Out From Her Womb, She's Guaranteed To Be Pregnant!!!

  • censoredcreampiebig titsTREprestigemichiru santreasureTRE-113TRE113118tre00113
    • 2019-09-06
    188 min

    [ABP-895]Maria Aine Is So Erotic And Cute, She's Practically A Living Cheat Code, And Now She's Luring You To Full-Force Temptation In 5 Dream-Cum-True Situations Maria Aine Will Use Every Trick In Her Book To Lure You To Temptation!!

  • maria aine censoredcosplaysingle workABPprestigemy brother akiraabsolutely perfectABP-895ABP895118abp00895
    • 2019-09-06
    115 min

    [ESK-310]Escalating Super Amateur Girl 310 Nene-chan 20 Years Old

  • censoredamateurESKprestigedamashiyaESK-310ESK310118esk00310
    • 2019-09-05
    157 min

    [SSNI-560]Total Domain Tall Girl Flashes Her Sexy Legs - A Nympho In Knee Highs Hotaru Nogi

  • nogi firefly censoredschoolgirlsingle workSSNIs1 no 1 stylegoemonSSNI-560SSNI560ssni00560
    • 2019-09-01
    132 min

    [GOJU-119]The Wet Pantyhose Of A Mature Woman - Kana Shiokawa

  • kana suruga censoredblowjobmature womanGOJUfifty somethingGOJU-119GOJU119h-1165goju00119
    • 2019-08-28
    25 min

    FC2PPV 1151367 Affair Housewife’s Sexual Confession Documentary [Nurse Married Woman Specializing in Night Shift] Two Consecutive Creampies For A 170cm Beautiful Leg Married Woman "You, I’m A Bad Woman. Should I Put A Cock Raw？" [Pe

  • amateur uncensoredfc2
    • 2019-08-23
    105 min

    [XRW-739]A Voluptuous Elder Sister In A Competitive Swimsuit Gets Her Thighs Assaulted By A Maso Man

  • himari ogawa yukina midwinter censoredXRWreal worksreal real worksXRW-739XRW739172xrw00739
    • 2019-08-17
    140 min

    [AES-002]The Sex Slave Pantyhose Banquet Yui Hatano Rika Mari Arisa Hanyu

  • yui hatano mari rika censoredbig titsslutAESaegea daydreamersgoro koenjiAES-002AES002aes00002
    • 2019-08-11
    117 min

    [DPMI-041]Campaign Girl Crazy Legs Sarina Kurokawa

  • sarina kurokawa censoredsingle workDPMImiludopamixDPMI-041DPMI041dpmi00041
    • 2019-08-03
    116 min

    [PRED-173]A True Love Sex Encounter Between An Older Sister In A Tight Skirt, And Me Who Only Managed To Pluck Up My Courage Once - Yume Sasaki

  • yume sasaki censoredcreampiesingle workPREDpremiumtake delegancePRED-173PRED173pred00173
    • 2019-07-27
    123 min

    [FNEO-032]My Boyfriend Is Practically A Shut-In, So He Never Fucks Me, But My Big Brother-In-Law Is Also Living With Us, And Thanks To Him, My Unfulfilled Life Was Changed Forever... A Female Student With Beautiful Legs Enjoys The Pleasures Of Being

  • one thousand three bells censoredbdsmsingle workFNEOfirst starbirdman teppeifirst star neoFNEO-032FNEO032h-491fneo00032



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download