karma marx voyeur bang bang 30 off




FC2SDABHDKAMARASQTEDTTMEYDSANNATRSSNISHKDMIDVFSDSSAUKSNACRDASDVENXGVHLULUCHRVCJOD

2020-10-25
68 min

[jrai-003]ななみ

  • amateur censoredamateurjraijrai-003jrai003jrai-003
    • 2020-11-05
    86 min

    [HTHD-181]My Friend's Mother - Final Chapter - Misono Takahashi

  • takahashi misono censoredcreampiemature womanHTHDcenter villageminatoyahanazono center villageHTHD-181HTHD181h-086hthd00181
    • 2020-11-22
    60 min

    FC2PPV 1579620 ★ Limited time 3980⇒2980pt ☆ Super rare first shot amateur ☆ Slender beauty BODY daughter Hinako who grew up in the country 18 years old ♥ Suddenly raw squirrel in an undeveloped pussy with 2 experienced people ♥ Excitement MAX cum sho

  • amateur uncensoredfc2
    • 2020-12-03
    58 min

    [per-348]くるみ

  • amateur censoredschoolgirlamateurperper-348per348per-348
    • 2020-12-04
    88 min

    [DHT-221]Picking Up A Married Woman And Making Her Cum With A Creampie - Aion, 30 Years Old

  • censoredcreampiemarried womanDHThot entertainmentyen ikkiDHT-221DHT22159dht00221
    • 2020-12-15
    72 min

    HEYZO 2423 Naughty Prank To The New Employee -Part2- – Hikari Endo

  • hikari endo uncensoredcreampiehandjobheyzo
    • 2020-12-23
    53 min

    374SHOW-038 Akemi

  • amateur censoredmarried womanamateurshowshow-038show038374show-038
    • 2020-12-25
    103 min

    HEYZO 2439 Creampie in Europe #Ginebra – Ginebra

  • ginebra uncensoredheyzo
    • 2020-12-26
    190 min

    [JKSR-473]Will You Have A D***k With Me Ma'am？ We Tried Getting A Married Woman To Swallow Liquor - And Cum. @ Shinjuku - Rural Wives Only - Picking Up Married Girls At A Bus Stop With Reasons To Cheat 7

  • censoredamateurJKSRbig morkalobockeyprink junkyJKSR-473JKSR47357jksr00473
    • 2021-01-06
    57 min

    [sika-025]るみちゃん(20)

  • amateur censoredbig titssquirtingsikasika-025sika025sika-025
    • 2021-01-16
    50 min

    C0930 hitozuma1345 Sonomi Hijiri 27years old

  • amateur uncensoredc0930
    • 2021-02-11
    54 min

    [orec-694]ももか

  • amateur censoredcreampiebig titsorecorec-694orec694orec-694
    • 2021-02-12
    130 min

    [DASD-816]I'll Cheat With Your No-Good Husband So You Can Divorce Him - 3-Star Agent Slut Hinako Mori

  • hinako mori censoreduniformsingle workDASDdaschinpo dazaiDASD-816DASD816dasd00816
    • 2021-02-19
    120 min

    [KSBJ-119]A Son's Wife Turned Out To Be A Lewd Woman, Through And Through... Maron Natsuki

  • marin natsuki censoredcreampieblowjobKSBJksb kikaku emmanuellebito sakuraKSBJ-119KSBJ119ksbj00119
    • 2021-02-19
    66 min

    [OTIM-056](For Streaming Editions) (Daydream POV Fantasies) I'm Getting Hyped With My Favorite Colleague At Work Sara Kagami

  • kagami sara censoredcreampieuniformOTIMprestigeonetimeOTIM-056OTIM056118otim00056
    • 2021-03-05
    115 min

    [PARATHD-3124]A Wife With Big Tits Who Was Continuously Fucked By Her Father-in-law, Whom She Hates, For 3 Days While Her Husband Was Away On A Business Trip

  • censoredcreampiebig titsPARATHDparadise tvPARATHD-3124PARATHD3124parathd03124
    • 2021-03-08
    38 min

    [ore-761]Kana

  • amateur censoredcreampieschoolgirloreore-761ore761ore-761
    • 2021-03-12
    75 min

    [orec-716]みつきちゃん 6

  • amateur censoredcreampieuniformorecorec-716orec716orec-716
    • 2021-03-15
    180 min

    [DIPO-090]Secretly Filmed Videos Released To The Publish! Secret Film Taken By Middle Aged Man And A Runaway Girl

  • censoredDIPOprimoero nandesuDIPO-090DIPO090h-283dipo00090
    • 2021-03-22
    245 min

    [AVS-024]AVS Collector's 2020 Annual SPECIAL BEST Catalogue

  • inaba natsuho imai censoredAVSavs collector savsAVS-024AVS024avs00024
    • 2021-03-25
    40 min

    H4610 ki210325 Sayuri Takagi 20years old

  • amateur uncensoredh4610
    • 2021-03-26
    118 min

    [CLUB-634]I Fell In Love With A Cheerful Slut And Seduced Her By Pretending I Was A Virgin. She Couldn't Help But Want To Break In A Sweet, Shy Boy Like Me And The Moment My Cock Met Her Big Tits She Fell In Love With My Erection. Part Two.

  • censoredbig titsuniformCLUBhentai shinshi clubCLUB-634CLUB634club00634
    • 2021-04-15
    120 min

    [KSBJ-132]This Big Tits Wife Had To Pay Back Her Husband's Debts By Using Her Body Sana Sanada

  • miki sanada miki sanada mizuki sanada censoredcreampiebig titsKSBJksb kikaku emmanuellebito sakuraKSBJ-132KSBJ132ksbj00132
    • 2021-04-15
    122 min

    [ZEX-403]*Warning* To The Brink Of Breaking! Super Intense Begging For Climax Sex Hono Wakamiya

  • honoka wakamiya censoredbig titssingle workZEXpeters maxZEX-403ZEX403h-720zex00403
    • 2021-04-17
    72 min

    300NTK-554 A miracle! !! Beautiful x cute quarter-rolling beautiful girl! !! We are proud of our whitening soft skin pink nipples and peach butt! !! Needless to say, the sensitivity is good. The owner of the squirting maco! !! Just a squirting profes

  • amateur censoredcreampiesquirtingntkntk-554ntk554300ntk-554
    • 2021-04-18
    240 min

    [BAZX-286]Gal *Para

  • censoredcreampieBAZXbazookatetBAZX-286BAZX286bazx00286
    • 2021-04-22
    122 min

    [IENF-136]Sexy Pantyhose At The Soapland 2

  • kurumi ito kashii hinano censoredcreampieIENFienergyienfIENF-136IENF1361ienf00136
    • 2021-04-24
    96 min

    [VENX-031]When Her Stepson Creampie Fucks Her, She'll Clean Him Up With A Blowjob, And Then Get Him Rock Hard Again So He Can Pump Her Pussy And Empty His Balls Out In An Endless Loop Of Shameful Fucking Sayuri Mitsumoto

  • sayuri mitsumoto censoredcreampiebig titsVENXvenussarufakecest winntersVENX-031VENX031venx00031
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-08
    238 min

    [NASH-505]Married Woman Babes Having Adultery Sex 4 Hours 11 Ladies It Feels So Good To Have Secret Sex Behind Your Husband's Back, And Super Satisfying To Go Cum Crazy And Have Massive Amounts Of Cum Ejaculated All Over You

  • censoredblowjobmature womanNASHnadeshikomitsuo okuNASH-505NASH505nash00505
    • 2021-05-16
    50 min

    Caribbeancom 051621-001 High School Reunion: Drunk Buffalo Game Has Escalated To Orgy Natsumi Hirose, Kanae Murakami

  • natsumi hirose uncensoredcreampielesbiancaribbeancom
    • 2021-05-20
    253 min

    [PIYO-116]Chicks Visit Your House! These Bitches Will Take Care Of You With Their Shaved Pussies.

  • ichika matsumoto lara kudo censoredPIYOchickclown fieldPIYO-116PIYO1161piyo00116
    • 2021-05-21
    55 min

    230OREC-775 Hana

  • amateur censoredcreampiebig titsorecorec-775orec775230orec-775
    • 2021-07-06
    59 min

    FC2PPV 1906372 [Appearance] Two times of vaginal cum shot at the hotel with fair-skinned bangers and translation ants

  • amateur uncensoredfc2
    • 2021-07-06
    70 min

    H0930 ki210706 Azusa Tamai 29years old

  • amateur uncensoredh0930
    • 2021-07-09
    75 min

    328HMDN-380 Shocking [Brood Parasite] Slender Beautiful Wife 35 Years Old SNS ＃ SEX Cum Shot Raw Sperm Donation Wife. Continuous seeding Ahe fell without pulling out to the powerful SEX of the unequaled cock younger than her husband.

  • amateur censoredcreampiemarried womanhmdnhmdn-380hmdn380328hmdn-380
    • 2021-07-10
    47 min

    C0930 ki210710 Reiko Hayami 43years old

  • amateur uncensoredc0930
    • 2021-07-12

    FC2PPV 1917845 [Fan Participation Type 4th] Hinata-chan is an amateur’s fingering! Raw SEX [Hinata Challenge] with a body that trembles

  • amateur uncensoredfc2
    • 2021-07-18
    140 min

    [MADV-510]Quickie Doggie-Style Fuck With A Huge Cock! Passionate Titty Fuck! Pounded And Bred With A Creampie! The Temptation Of A Hot Slut With Colossal Tits And Huge Ass Rio Ohara

  • osamu osamu censoredcreampiebig titsMADVcrystal eizomaniac crystalMADV-510MADV510madv00510
    • 2021-07-30
    32 min

    359TYVM-178 Too Much Masturbation! ？？ A Fifty Wife Who Shyly Says That Her Clitoris Is Big. Her Son Leaves The Nest And Has Time To Immerse Himself In Masturbation, But She Is 53 Years Old Who Is Not Enough And Dabbles In Another Stick.

  • amateur censoredcreampiemarried womantyvmtyvm-178tyvm178359tyvm-178
    • 2021-08-01
    61 min

    HEYZO 2578 Naked Girlfriend POV -Raven Haired Slutty Amateur Girl- – Nobuko Matsumoto

  • amateur uncensoredcreampieheyzo
    • 2021-08-02
    66 min

    SIRO-4591 [First Shot] [Sensitive Glossy Skin] [Cum Every Minute] Sensitive Body Nursery Teacher Who Switches On Immediately. Every Time I Die, My Body Seems To Be Irritable And Repeats Countless Cums .. AV Application On The Net → AV Experience Shoo

  • amateur censoredamateursirosiro-4591siro4591siro-4591
    • 2021-08-06
    35 min

    FC2PPV 1962287 None [Limited To 100 Pieces 2980 → Off To 1480pt!] This Girl’S Blowjob Is Too Amazing! De Metamorphosis! Instead Of A Nyodo Straw, Suck Up Chuchu Gaman Juice! * Review Benefits / High Image Quality Ver

  • amateur uncensoredfc2
    • 2021-08-20
    116 min

    [HZGD-197]Homestay Guy Fucks Beautiful Scandinavian Wife With Big Tits Lily Hart

  • lily heart censoredcreampiebig titsHZGDhitodzuma hanazono gekijouzampaHZGD-197HZGD197h-1100hzgd00197
    • 2021-08-21
    241 min

    [MDBK-193]A Traditional Japanese Beauty With Beautiful Big Tits Will Welcome You At A Super High-class Yukata Health Establishment: 4 Hours Complete BEST

  • kirishima sakura kurata mao censoredcreampiebig titsMDBKk m producek taroubazookaMDBK-193MDBK193mdbk00193
    • 2021-08-24
    88 min

    300MAAN-689 [Muttsuri Aniota JD X Erokosu Bukkake] A Naive Half Jd Raised In A Girls’ School Is An Otaku Girl Who Inflates Her Delusions With Naughty Anime! I Can’T Stand Masturbation Anymore! Uncontrollable Desire Goes Wild In The Long-Awa

  • amateur censoredcreampieamateurmaanmaan-689maan689300maan-689
    • 2021-09-06
    69 min

    FC2PPV 2158392 Active Third Grader Of Fair-Skinned Beautiful Milk E Cup. Although She Is A Small Animal Raised In The Countryside, A Large Amount Of Love Juice Overflows From Her Vagina. She Secretly Half Vaginal Cum Shot While Watching The Swaying B

  • amateur uncensoredfc2
    • 2021-09-09
    151 min

    [FSDSS-295]This Horny Slut Will Whisper Polite Dirty Talk Into Your Ear While Slowly Toying With Your Nipples And Ejaculating Your Cock Over And Over Again At This Men"s Massage Parlor Until You"re Hopelessly Hooked Momo Honda

  • honda peach censoredbeautiful girlsingle workFSDSSfalenomiyabi aoyamafaleno starFSDSS-295FSDSS2951fsdss00295



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download