imagine




FC2VEMAMIDVPREDWAAASSISMARAMIDEKSBJMEYDDTTNGODAUKGCHRVKBIABWSSNINATRSPRDVENXAPOD

2020-11-27
238 min

[SIM-100]College Girl Wild C***d Takes Pity On A Male Virgin And Agrees To Punch His V-Card! Lust And Maternal Instinct Kick In At The Same Time For This Horny Slut!

  • censoredcreampiebig titsSIMprestigeamateur pussiesSIM-100SIM100118sim00100
    • 2020-11-29
    160 min

    [LULU-048]My Convenient Big Ass Pet Who Loves Me Too Much She Looks Cute But Her Pussy Is A Crude And Rude Fucking Machine Because This Obedient Maso Bitch Will Scream And Shout And Go Insane With Orgasmic Pleasure! Kanae Kawahara

  • kanae kawahara censoredcreampiesingle workLULUlunaticsluminaxLULU-048LULU048lulu00048
    • 2020-12-01
    241 min

    [C-2601]Please Sleep With My Wife The BEST 2019.04-2020. 03

  • censoredCgogostakeshi karakigogo s coreC-2601C2601140c02601
    • 2020-12-05
    120 min

    [JUL-397]I Let Them Have My Wife In Secret... The Wannabe Cuckold Who Planned His Wife's Cheating Creampie Group Sex--Hinata Koizumi

  • hinata koizumi censoredcreampiebig titsJULmadonnatakeshi kogaJUL-397JUL397jul00397
    • 2020-12-07
    45 min

    [ore-736]ひなこ(20)

  • amateur censoredamateurblowjoboreore-736ore736ore-736
    • 2020-12-12
    46 min

    FC2PPV 1603464 No35 Celebrity-level looks beautiful girl is active as a dad for school expenses. Makoto 1 I took a secret shot of a cute real amateur in history.

  • amateur uncensoredfc2
    • 2020-12-22
    61 min

    HEYZO 2421 Exploring Every Corner Of A Cute Girl! – Sena Kusunoki

  • sena kusunoki uncensoredcreampieheyzo
    • 2020-12-23
    53 min

    374SHOW-038 Akemi

  • amateur censoredmarried womanamateurshowshow-038show038374show-038
    • 2020-12-26
    155 min

    [MIAA-371]Double Temptation Of Two Former Girlfriends: Whispering Dirty Slutty Talk Into Both My Ears, And Making Me Creampie Them! With Ai Mukai And Noa Eikawa

  • ai mukai sakaegawa noa censoredcreampieslutMIAAmoodyzham the mceveryone s porn starMIAA-371MIAA371miaa00371
    • 2021-01-07
    60 min

    336KNB-136 Exactly “man-eater”! !! Frustration and good affair! Good vaginal cum shot! !! A slender married woman who eats infinite Ji ○ port who tries to squeeze sperm even after ejaculation appears! !! I will take a gonzo with this marrie

  • amateur censoredcreampiemarried womanknbknb-136knb136336knb-136
    • 2021-01-08
    48 min

    FC2PPV 1620918 [Limited quantity] Gachi hidden shooting ❤️ H cup beauty big breasts business trip men’s beauty treatment salon hidden shooting with 3 cameras ❤️ Immediately deleted if barre

  • amateur uncensoredfc2
    • 2021-01-09
    118 min

    [IPX-599]"I Think I'm Better Than Your Wife..." Cheating Blowjob Sex - Immoral Slut Seduces Married Men To Suck Them Off Tsubasa Amami

  • amami tsubasa censoredcreampieblowjobIPXidea pocketinaballdishIPX-599IPX599ipx00599
    • 2021-01-09
    46 min

    279UTSU-479 Yurika

  • amateur censoredmarried womanamateurutsuutsu-479utsu479279utsu-479
    • 2021-01-17
    127 min

    [MRSS-104]I Looked Through My Wife's Phone And Found A Whole Collection Of POV Sex Tapes From The Time She Was A S*****t Made With Her Homeroom Teacher Yui Hatano

  • yui hatano censoredcreampiesingle workMRSSmisesu no sugao emmanuelleichiro yumisakimisses amateur faceMRSS-104MRSS104mrss00104
    • 2021-01-23
    135 min

    [JUL-442]A Revival Of An Exclusive Madonna Label Actress No.2!! I Went On A Business Trip With My Favorite Lady Boss, And To My Surprise, We Were Booked Into The Same Room At A Business Hotel Asahi Mizuno

  • mizuno chaoyang censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-442JUL442jul00442
    • 2021-01-23
    69 min

    200GANA-2420 Seriously Nampa, first shot. 1586 Get a gal who is cheating on a man in dating! The best blowjob maximizes comfort! Shaved Oma ● Every time you make a piston, it tightens powerfully as if it expresses comfort! This is my uncle’s bes

  • amateur censoredamateurganagana-2420gana2420200gana-2420
    • 2021-01-24
    100 min

    [SRMC-028]Sensual Approach Of A Big Butted Wife Reiko Kobayakawa

  • kobayakawa reiko censoredslutsingle workSRMCh m rashmiyoshi rusherSRMC-028SRMC028srmc00028
    • 2021-02-17
    51 min

    [sika-040]みさみさ 2(20)

  • amateur censoredcreampieamateursikasika-040sika040sika-040
    • 2021-02-21
    116 min

    [HND-948]She's Lifting Her Creampie Ban For The Very First Time You Get To Exclusively Rent A Former Idol For 2 Days And 1 Night And Have Infinite Creampies Until Your Time Runs Out A Hot Spring Resort Vacation Special Featuring 10 Ejaculations F

  • minano sora censoredcreampieblowjobHNDhon nakatiger kosakaiHND-948HND948hnd00948
    • 2021-02-22
    36 min

    FC2PPV 1697756 [No] ♯ Fair-skinned ex-girlfriend on a slope. I cooked a vaginal cum shot of ex-girlfriend with flirting on the bed.

  • amateur uncensoredfc2
    • 2021-02-24
    179 min

    FC2PPV 1699100 049 [Facial cumshot from cum] That super popular sexy actress made a crispy beauty drink a lot of sperm and made her face dirty

  • amateur uncensoredfc2
    • 2021-03-05
    81 min

    [BTHA-063]Shaved Pussy ~ Uncensored Small Beautiful Cutie / Former Idol H]ZH

  • censoredbeautiful girlBTHAsupa kubijonBTHA-063BTHA063
    • 2021-03-05
    480 min

    [TRE-155]Amateur TV X PRESTIGE - Ultra-Sensitive Girls - Incredible Episodes - BEST Collection Vol. 2 - Beautiful Young Babes With Sensitive Bodies Cum So Hard You Won't Be Able To Look Away!

  • censoredamateurTREprestigetreasureTRE-155TRE155118tre00155
    • 2021-03-05
    29 min

    FC2PPV 1658698 [First time limited 1980pt → 1200] GoPro video full of immersive feeling ❤️ Trajectory to M woman ❤️ Fainting convulsions with a thick vibe after insulting an active beautiful girl JD who is too beautiful with a ball gag ❤️ Superb blow

  • amateur uncensoredfc2
    • 2021-03-07
    135 min

    [DNJR-046]"I'm Going To Be Breaking In Your Body Alot, Okaaaaaaay？ You Have To Obey Whatever I Say, Okayyyyyyy？" The Spoiled S*****t Council President And Her Maso Man Boy Toy's Journal Of Love Yui Kawai Chiaki Uehara

  • yui kawai chiaki uehara censoredbeautiful girlslutDNJRdog daydreamersmaboroshikoDNJR-046DNJR046dnjr00046
    • 2021-03-17
    12 min

    FC2PPV 1699831 [Personal shooting] Hiromi 41 years old Short SEX remastered version [Limited time offer]

  • amateur uncensoredfc2
    • 2021-04-09
    166 min

    [MKMP-390]First Time Being Fucked Raw Three Times Getting Her Pussy Filled With Thick Cum Nako Hoshi

  • nako hoshi censoredcreampiebeautiful girlMKMPk m producezaku araimillionMKMP-390MKMP390mkmp00390
    • 2021-04-14
    120 min

    [SSIS-044]Lured By (Panty Shots, Thighs, Whispered Seduction). Giving In To The Temptation Of My Own S*****ts - After School At A Love Hotel, Day After Day, Forbidden Sex... Izuna Maki

  • izuna maki censoreduniformschoolgirlSSISs1 no 1 styleichigoharaSSIS-044SSIS044ssis00044
    • 2021-04-15
    91 min

    [KEED-067]My Girlfriend's Mom Seduced Me With Her Hot Lingerie And I Gave Her A Creampie Yuko Matsuda

  • yuko matsuda censoredcreampiemature womanKEEDcenter villagemitsusato koutarouhanazono center villageKEED-067KEED067h-086keed00067
    • 2021-04-17
    116 min

    [NNPJ-443]I Offered The Bold Babe Who Was Giving Me A Business Trip Massage A Huge Tip And To My Surprise She Was Down To Fuck For It Sarina

  • censoredcreampiebig titsNNPJnanpa japanNNPJ-443NNPJ443nnpj00443
    • 2021-04-24
    91 min

    383REIW-057 Ranka

  • amateur censoredcreampieamateurreiwreiw-057reiw057383reiw-057
    • 2021-04-30
    244 min

    [HEZ-277]Her Husband Doesn't Know Where This Unfaithful Housewife Is Getting Fucked - Her Prim, Pretty Face Is Hiding A Wild Horny Side Who Wants To Take Another Man's Creampie 2 12 Girls

  • censoredcreampiemarried womanHEZhot entertainmenthot premium archiveHEZ-277HEZ27759hez00277
    • 2021-05-25
    51 min

    FC2PPV 1834384 Discount only for the first time ★ 19-year-old masochist virgin is not enough for erotic comics and is a man fishing. Unauthorized disclosure of the training appearance of a perverted woman who is excited about this for the first time

  • amateur uncensoredfc2
    • 2021-06-05
    166 min

    [MEAT-032]Completely Unequaled! Cock Addict Piston Teacher - Chitose Yuki

  • chitose in the evening censoredbig titssingle workMEATbig fleshy road family daydreamMEAT-032MEAT032meat00032
    • 2021-06-11
    153 min

    [JUFE-296]Competitive Eater With An Insatiable Appetite For Food... And Cock! Pretty Grown Up Slut With A Sweet Smile - This Former Beach Volleyball Player Voraciously Devours Anything Put In Front Of Her In Her Porn Debut!

  • censoredbig titsJUFEfitchJUFE-296JUFE296jufe00296
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-20
    120 min

    [SRMC-033]Hypno-drama: A Wife With A Big Ass Drowning In Influenced Pleasure - Yurika Aoi

  • yurika censoredsquirtingsingle workSRMCh m rashmiyoshi rusherSRMC-033SRMC033srmc00033
    • 2021-07-08
    48 min

    FC2PPV 1911064 [Rare item] Beautiful athlete outflow ③ Face and milk are amazing

  • amateur uncensoredfc2
    • 2021-07-16
    119 min

    [HZGD-194][I Can't Resist Anymore!] MILF With Huge Tits Fucking Son's Best Friend - Aya Hoshino

  • aya hoshino censoredcreampiebig titsHZGDmarried woman flower garden theaterhirokoji osakiimage married woman flower garden theatHZGD-194HZGD194h-1100hzgd00194
    • 2021-07-22
    59 min

    H4610 ki210722 Haruka Yumeno 23years old

  • amateur uncensoredh4610
    • 2021-07-30
    240 min

    [DVDMS-695]Eyes On Ordinary Guys And Girls - Amateur College Girl Co-Eds Only! We Found College S*****t Singles To See If They"ll Fall In Love After Just A Kiss... And If So, Would They Have SEX Right After？ The Two Of Them Enchanted After Just A

  • censoredcreampieamateurDVDMSdeepsiwanagadeep sDVDMS-695DVDMS695dvdms00695
    • 2021-08-21
    80 min

    FC2PPV 2059595 [9980 → Weekend Limited 2980] A Neat And Elegant 22-Year-Old G-Cup Nursing Student ❤️ Miracle Gonzo ❤️ Eyes Bluntly Die With A Generalized Erogenous Zone ❤️ Ahegao Opens Up Sexual Desire ❤️ Boiling Ejaculation At The Uterine Ostium ❤️

  • amateur uncensoredfc2
    • 2021-08-26
    68 min

    FC2PPV 2077664 A 21-Year-Old Fair-Skinned Beautician I Met At A Street Corner Pick-Up Bar. First-Time Sex Machine Gun Launch!

  • amateur uncensoredfc2
    • 2021-09-06
    74 min

    FC2PPV 2163912 [First Thing] Legal Loli, High School Graduate Who Looks Younger Than Age 1st Year [3p, Free Nymph] Cum Inside Cusco! She Was A Bright Girl With A Good Personality Who Responded With A Smile.

  • amateur uncensoredfc2
    • 2021-09-09
    143 min

    [GUN-757]Vibrator Masturbation With Super Small Swimsuits 2

  • karen anba marina saito censoredsquirtingGUNradixsakuraba kyuu kokoro otokobatsugunGUN-757GUN757433gun00757
    • 2021-09-09
    93 min

    [OKS-119]Luna Tsukino. Wet Glistening School Swimsuit That Clings To Her. A Cute Girl In A Dripping Wet School Swimsuit Is The Best! Starting With An Outfit Change While Peeping, Small Tits To Big Tits, Shaved Pussy, Pussy Hair Sticking Out, Armpits

  • tsukino luna censoredschoolgirlbeautiful girlOKSoyaji no kosatsukami sukumizuOKS-119OKS1191oks00119
    • 2021-09-12
    60 min

    SIRO-4626 [First Shot] [Good Shape E Milk] [Continuous Squirting] Arasa Apparel Clerk’s Uncontrollable Libido. A Body That Is Ripe With Outstanding Sensitivity Is Intensely Pissed By A Person Other Than A Boyfriend, And The Fruited E Milk Is Sha

  • amateur censoredbig titssquirtingsirosiro-4626siro4626siro-4626
    • 2021-09-25
    120 min

    [SRMC-036]Influencer RED vs. Ayaka Mochizuki - Cute Influenced Bitch Ayaka Mochizuki

  • ayaka mochizuki censoredcreampiebig titsSRMCsaimin rashrassha miyoshiSRMC-036SRMC036srmc00036



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download