huge breasts




FC2GVHCJODATIDWANZPPPDDASDVEMAWAAAGMEMSQTEFSDSSSANPREDONEZJULAWDMEYDROYDDASDKSBJ

2023-04-22
240 min

GIGL-698 A Plump Belly Mature Woman! Huge Breasts! Big Ass! An Obscene Slack Wraps Around Ji Po! Masterpiece Meat Indulgence Dense SEX Hidden Shooting 4 Hours

  • amateur censoredbig titsmature womanGIGLgigolo gigoloGIGL-698GIGL698gigl00698
    • 2023-04-22
    124 min

    300MIUM-914 [G-Cup Female College Student From Kyoto] Rent An Active JD With Huge Breasts As Her! Complete Rec Of The Whole Story Of Spearing Up To Erotic Acts That Are Originally Prohibited By Persuasion! ! A Graceful JD With A Graceful Kyoto Dialec

  • amateur censoredcreampiebig titsmiummium-914mium914300mium-914
    • 2023-04-21
    100 min

    390SNB-004 [Top Secret Recording] A Record Of A Very Constricted And Highly Conscious Influencer Who Was Annoyed By Her Huge Breasts

  • amateur censoredcreampiebig titssnbsnb-004snb004390snb-004
    • 2023-04-21
    60 min

    fc2-ppv 3269433 * Limited Quantity For The First Time * [Reward/Creampie] Etch "Tsuoi" Sister Nanami 25 Years Old A Record Of Training A Big Cock Man Until It Becomes Sticky With Patience Juice FC2-PPV-3269433

  • amateur uncensoredcreampieamateur
    • 2023-04-21
    32 min

    fc2-ppv 3269724 *Limited First Time 2930pt → 1930pt [Complete Appearance] [Creampie / Uncensored] Support For The 3rd Time For A Married Woman With H Cup Breasts. Plenty Of Continuous Vaginal Cum Shot In The Body As Usual. FC2-PPV-3269724

  • amateur uncensoredcreampiemarried woman
    • 2023-04-19
    85 min

    336KNB-250 Invite A Young Wife With A Preeminent Style Of Bonkyubbon To Her Home And Shoot An AV! "My Husband Isn"t Enough, So I Tried Cheating, But I Want More Stimulation♪" This Wife"s Breasts And Buttocks Are Huge, But Her Chestnut

  • amateur censoredcreampiebig titsknbknb-250knb250336knb-250
    • 2023-04-18
    73 min

    fc2-ppv 3264427 [Nothing] [Gonzo 390] Plenty Of Facial Cumshots And Gutsy AF For A Perverted Perverted Busty Girl! Plenty Of Training With An Anal Plug! I Got So Caught Up In My Denma That It Blew Up (laugh) And Ended Up With A Huge Amount Of Vaginal

  • amateur uncensoredanalcreampie
    • 2023-04-18
    62 min

    INSTV-425 [Big Breasts! Brain Killing Sexy Mrs. Muscle Vs Kcup Huge Breasts Celebrity Mrs. Rich Pheromone Majin! All Mankind"s Erection Inevitable Sexy Wife Is Demonized With Muscle Raw Cock! 3P To Fall By Seeding! The World"s Most Horny Fema

  • amateur censoredbig titsINSTVfuck photo rinet work second editionINSTV-425INSTV425
    • 2023-04-15
    56 min

    fc2-ppv 3260806 [Nothing] Ayano-chan, A Powerful H-cup Caregiver Who Is Just Saying That Big Breasts Are Justice! ! Huge Breasts Shaking ♪ A Large Amount Of Vaginal Cum Shot To A Threatening Pie Pressure Beauty Who Is Inevitable Erection! ! FC2-PPV-3

  • amateur uncensoredcreampieamateur
    • 2023-04-15
    241 min

    ERDM-036 Huge Breasts Quake! 20 Women, 4 Hours

  • nachi kurosawa arisa hanyu arisu hanyu censoredcreampiebig titsERDMERDM-036ERDM036erdm00036
    • 2023-04-15
    52 min

    fc2-ppv 3261255 [Personal Shooting] Icup Busty Married Woman Kyoko 32 Years Old. Nasty Wife Gonzo Creampie Sex With A Young Man Until Morning Leaked Video [Unequaled] FC2-PPV-3261255

  • amateur uncensoredcreampiemarried woman
    • 2023-04-15
    48 min

    fc2-ppv 3261715 * Prepared For Lawsuits [without Permission] A Famous Child Actor Who Appeared In N○K. Finally Re-breaking With Tikt○k, Her Life Is Now Confirmed. She Has A Baby Face, But When She Takes It Off, She Becomes An Adult. She Can"t Sta

  • amateur uncensoredamateur
    • 2023-04-14
    179 min

    MIDV-273 W Huge Breasts Pinching! Titty Fuck Creampie Unlimited Ejaculation Raw Customs Dynamite Yumemiru Yuria Yoshine

  • dream yoshine yuria censoredcreampiebig titsMIDVmoodyzMIDV-273MIDV273midv00273
    • 2023-04-14
    76 min

    300NTK-811 [H Cup Huge Breasts OL Adult Ban SP! ! ] [Big Breasts! ! Obedient! ! Bright Dirty Little Schoolgirl! ! ] [Cospa & Hospitality Matching With The Strongest Echimuchi Beauty! ! ] Aggressive P Active Girl Is A Light Erotic Special! ! Break Thr

  • amateur censoredcreampiebig titsntkntk-811ntk811300ntk-811
    • 2023-04-12
    63 min

    COSX-037 Is There Anyone Who Doesn"t Rub This？ Isn"t There？ Cosplay Costume Wins The Selfish Lewd BODY Of Alice With Blonde Huge Breasts H-cup Layer!

  • amateur censoredbig titsamateurCOSXold guys filming pov cosplay sexCOSX-037COSX037cosx00037
    • 2023-04-12
    59 min

    fc2-ppv 3257846 [Huge Breasts I Cup] Darkness Of The Entertainment World Rookie Gravure Kotomi (23) Sex-loving Gravure Idol Cosplay Pillow Sales Video Leaked [personal Photography] FC2-PPV-3257846

  • amateur uncensoredcreampieamateur
    • 2023-04-14
    150 min

    BANK-118 Creampied Open-Air Hot Spring K-Cup Whipping Big Ass Huge Breasts Kinky Older Sister

  • censoredcreampiebig titsBANKmako banktake chanBANK-118BANK118h-1495bank00118
    • 2023-04-08
    122 min

    MUCH-165 Minami Momo, A Beautician With Huge Breasts Who Is Rumored To Be Too Erotic Locally

  • minami peach censoredcreampiesingle workMUCHmuchimucchi delusional tribemuchimuchiMUCH-165MUCH165much00165
    • 2023-04-08
    108 min

    KTRA-512 I Found Echinako! #2 Just Av On The Way Home From Work! I Had Sex With A Store Clerk With Huge Breasts I Saw At A Restaurant In Town While Wearing A Uniform And Got Creampied! Honoka Airi

  • honoka airi censoredcreampiesingle workKTRAk tribeKTRA-512KTRA512ktra00512
    • 2023-04-08
    241 min

    MMMB-094 100 Cm Plump, Boneless, Huge Breasts, And Huge Butts Are So Obscene And Bothersome! Massive Shots At Huge Butts That Are Too Lewd! 2

  • censoredcreampieMMMBmellow moonMMMB-094MMMB094mmmb00094
    • 2023-04-08
    151 min

    CHRV-176 Reading Sensual Novels Aloud To My Sister Who Masturbates, Big Brother Bing Bintaro! My Little Sister'S Huge Breasts Are Worth Seeing! Sailor Uniform Gets Creampied! H Cup 99Cm Walnut

  • censoredcreampiesisterCHRVcherries rebo delusioncherries reboCHRV-176CHRV176chrv00176
    • 2023-04-08
    151 min

    CHRV-177 Practice With Your Older Brother'S Naughty Recorder! My Little Sister'S Huge Breasts Are Worth Seeing! Sailor Uniform Gets Creampied! G Cup 93Cm Hmm

  • censoredcreampiesisterCHRVcherries rebo delusioncherries reboCHRV-177CHRV177chrv00177
    • 2023-04-07
    59 min

    MFTH-001 I Haven'T Taken Care Of It At All! There'S A Huge Gap Between Her Thick, Furry Hair And A Beautiful Girl With A Short Cut! If Your Crotch Is Pressed By A Horny Junior With Big Breasts And Seduces You While Using An Accent... Go Bareback In Y

  • censoredcreampiebig titsMFTHworks faleno tubeMFTH-001MFTH0011mfth00001
    • 2023-04-07
    60 min

    fc2-ppv 3251673 ☆ Resurrection (celebration) ☆ National Treasure Icup Beautiful Big Breasts [Limited Sale For 3 Days] Vtuber Healing ○ Choco, Otoha-chan Fans, Thank You For Waiting. How About A Virgin-kun Darkness Cosplay Paizuri？ FC2-PPV-3251673

  • amateur uncensoredcosplay
    • 2023-04-05
    62 min

    fc2-ppv 3249840 * Today Only 1980pt [Individual] A Love Cup Huge Breasts Model With A Total Of 200,000 Followers Who Has Decided To Appear In Seki Colle. Although She Is Shy, She Erects Her Nipples And Walks Around The City. She Couldn"t Hide Her

  • amateur uncensoredcreampiecosplay
    • 2023-04-01
    75 min

    fc2-ppv 3245780 * First Time Limited Quantity * [Individual Shooting/punishment Ejaculation Competition] F Cup Huge Breasts Girlfriend Shiori (24) ☆ PT ② ☆ Non-stop Raw Copulation As A Punishment For Cheating Continuous Firing To A Dirty Body [Creamp

  • amateur uncensoredcreampieamateur
    • 2023-03-31
    63 min

    fc2-ppv 3244910 [Large Release For A Limited Time Only! 10000pt➡1980pt] <H-cup Busty Boyne-chan> When You Take It Off, It"s Amazing Big Breasts! Straddling Raw Cock And Huge Breasts Purunpurun! Instinct Bare Climax-Forbidden Unauthorized Vagi

  • amateur uncensoredcreampieamateur
    • 2023-03-31
    22 min

    fc2-ppv 3245352 Tricking A Big-breasted JD Who Wants To Be A Gravure Into A Camera Test And Taking A POV 2 "Leaked Obscene Video Of The President Of An Entertainment Agency" FC2-PPV-3245352

  • amateur uncensoredcreampieblowjob
    • 2023-03-30
    24 min

    fc2-ppv 3244517 [2005 Grade] Cat Eye Huge Breasts I Cup, Full Breasts Shake, Sandwiched Ejaculation FC2-PPV-3244517

  • amateur uncensoreduniform
    • 2023-03-29
    38 min

    fc2-ppv 3241633 [Uncensored] "I Have A Complex About Having Big Boobs..." The Supreme Rough Stone That Worries About H Cup Huge Breasts. Uncle"s Saliva And Lotion Soft Boobs Slimy Play Teaches How To Please A Man. The Last Is Covered With

  • amateur uncensoredamateur
    • 2023-03-29
    71 min

    FC2PPV 3241897 Limited Time ❤️ Natural And Mysterious Found In Aomori Is A Chubby Girl With Super Huge Breasts ❤️ In Addition, A Tightening Masterpiece Of A Different Dimension Universe ❤️ 2 Consecutive Shots In A Black Hole

  • amateur uncensoredcreampieamateur
    • 2023-03-28
    31 min

    fc2-ppv 3241277 [Continuous Vaginal Cum Shot] <Slope Idol Face G Cup Girl> Now Is The Season! Innocent Libido Too Juicy! I Enjoyed The Rich Sex With Huge Breasts! ! FC2-PPV-3241277

  • amateur uncensoredcreampieamateur
    • 2023-03-28
    31 min

    fc2-ppv 3241255 She"s Skinny And Has Big Breasts, And She"s Still A Student. A 19-year-old F-cup Tutor Part-time Job. FC2-PPV-3241255

  • amateur uncensoredamateur
    • 2023-03-28
    45 min

    fc2-ppv 3241576 First Shooting / Appearance! ! Today Only 1980pt! ! No, You"re Making Too Many Claims! ？ A Natural Hcup Paisla Beauty Who Seems To Provoke The World"s Men... Full Erection And Unavoidable Powerful God Milk Titty Fuck Is Given

  • amateur uncensoredcreampieamateur
    • 2023-03-25
    29 min

    fc2-ppv 3237392 Autism Spectrum Syndrome Sexual Knowledge 0 Busty Beauty Hiring People With Disabilities First Shot FC2-PPV-3237392

  • amateur uncensoredamateur
    • 2023-03-25
    242 min

    NASH-865 Massive Firing On A Plump Plump Sister'S Huge Breasts And Butt For 4 Hours

  • censoredcreampiebig titsNASHpinknadeshikoNASH-865NASH865nash00865
    • 2023-03-25
    129 min

    ONSG-062 Big Breasts Call Girl Sei Ritoa

  • seiri censoredcreampiebig titsONSGgain corporationONSG-062ONSG062onsg00062
    • 2023-03-24
    154 min

    SSIS-592 I Want To Be Sandwiched Between Huge Breasts Like This... Men Can'T Put Up With That Tit. Boob Slutty Adachi Yuri Makes Her Dick Trotter

  • adachi yuri censoredbeautiful girlslutSSISs1 no 1 stylegoemonSSIS-592SSIS592ssis00592
    • 2023-03-24
    56 min

    032423_01 I Tried To Make A Shaved Pussy Of A Huge Breasts Girl With An Erotic Baby Face!

  • amateur uncensoredcreampieamateur
    • 2023-03-21
    76 min

    435MFCS-062 [If You Take It Off, You"ll Have A Huge Breasted Dirty Little Schoolgirl BODY X Almost A Virgin] God-waiting Runaway Girl] A Sober-eyed Potato Kid (18 Years Old) Picked Up On SNS And A Compensated Dating POV! ! Huge Breasts That Pop W

  • sound censoredcreampiebig titsmfcsmfcs-062mfcs062435mfcs-062
    • 2023-03-21
    73 min

    300MIUM-880 Enchanting Erotic Body [pita Bread Beautiful Big Butt X Beautiful Huge Breasts F Cup] "If You Join Our Community, You Can Get Everything ♪" Nico Nico Recommends Protein & Membership, But Somehow Hotain! It"s Amazing When You T

  • amateur censoredbig titsamateurmiummium-880mium880300mium-880
    • 2023-03-19
    40 min

    fc2-ppv 3218444 [Individual Shooting Uncensored] I Was Able To Meet The God Style Huge H Cup Again, So I Have Raw Sex FC2-PPV-3218444

  • amateur uncensoredamateurblowjob
    • 2023-03-18
    92 min

    563PPZ-017 [F Cup In Middle School / Current I Cup] Beautiful Huge Breasts Amateur With A Half-talent Face! ! Blame The Erogenous Zone Nipples And Mako! ! Experience The Ultimate Fucking Of Happiness Level MAX! ! [Boob Zuriko. ]

  • amateur censoredbig titssquirtingppzppz-017ppz017563ppz-017
    • 2023-03-18
    46 min

    fc2-ppv 3215838 [Individual Shooting] Super Milk M Cup Gonzo Video Leak Of A Certain Famous Voice Actor S Who Does Not Appear

  • amateur uncensoredblowjob
    • 2023-03-18
    128 min

    CHCH-031 Super Plump Amateur Wife With Huge Breasts Who Has Been Sexless For 20 Years, Forgets About Pleasure After A Long Absence. Misato (43 Years Old/K-Cup)

  • censoredCHCHchichi to haha emmanielbreasts and motherCHCH-031CHCH031chch00031
    • 2023-03-18
    87 min

    fc2-ppv 3216009 18 Years Old With The Best Body With Amazing G Cup God Milk Of Purunpurun. She Can"t Stand The Tiny Pink Pussy That Is Too Sensitive, And She Squirts A Lot, And At The End, She Releases Semen Into A Thick Vaginal Cum Shot And G Cu

  • amateur uncensoredcreampie
    • 2023-03-18
    32 min

    fc2-ppv 3215875 *Limited First Time 2930pt → 1093pt [Complete Appearance / Creampie] A Married Woman With H Cup Breasts Asked For Support Again, So I Told Her To Come In Underwear Under The Coat, And She Really Came. FC2-PPV-3215875

  • amateur uncensoredmarried womanamateur
    • 2023-03-17
    150 min

    MVSD-539 Sensual Sex Mansion With Queues Huge Breasts! Big Ass! A Voluptuous Wife'S Do-Suke Bareback Cock Service Yuki Chitose

  • chitose in the evening censoredslutsingle workMVSDm 039 s video groupm s video groupMVSD-539MVSD539mvsd00539



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download