generation z




FC2ATIDMIDVJUFENNPJROYDFSDSSDTTCHRVSQTEAUKSRBDVENXHMNMARASPRDSHKDMILKMEYDGVHNATR

2020-11-30
44 min

FC2PPV 1589814 “Main story appearance” [4K shooting] There is a reason why Iku and the ass hole are tingling her Gonzo! Erotic mode fully open with super glossy pantyhose naked! !! I firmly injected thick semen into the pussy.

  • amateur uncensoredfc2
    • 2020-12-04
    226 min

    [DOCP-262]Did I Mistake My Girlfriend's Little Sister For My Girlfriend And Give Her An Insta Fuck!？ I Only Realized My Mistake After I Ejaculated, So I Desperately Tried To Apologize, But Now She Was Hot And Horny, And Started Shaking Her Ass An

  • horikita wan mai takeda censoredcreampiesisterDOCPprestigedoc premiumDOCP-262DOCP262118docp00262
    • 2020-12-06
    120 min

    [URKK-033]Bust That Nut At Least 10 Times!! Aphrodisiac Parlor Where You Make A Slut's Big Titties Shake As You Creampie That Pussy As Many Times As You Want! Nene Tanaka

  • nene tanaka censoredcreampiebig titsURKKunfinishedwild sevena familiar breastURKK-033URKK033urkk00033
    • 2020-12-17
    66 min

    SIRO-4366 [First shot] [Big breasts x obscene ass x lewd eyes] [Instinct of an unfussy beauty] The attractive look with the switch tickles the ejaculation mind of a man. Rich sexual intercourse with an obscene ass beauty .. AV application on the net

  • amateur censoredbig titsamateursirosiro-4366siro4366siro-4366
    • 2020-12-25
    57 min

    FC2PPV 1603395 [No] The best masterpiece of 2020! Example Aya and Creampie 3P! No, it ’s really the best! Super angel! !! 【selfie】

  • amateur uncensoredfc2
    • 2020-12-26
    66 min

    [mntj-041]あおい

  • amateur censoredamateurmntjmntj-041mntj041mntj-041
    • 2020-12-26
    40 min

    FC2PPV 1621403 [18 years old] Del del Regal-chan [Angel]

  • amateur uncensoredfc2
    • 2020-12-31
    123 min

    [EUUD-034]Unexpected Delivery Right To A Fan's House! Wanna Try Out Yukari Orihara ？ - Creampie Sex With The Mature Woman Of Your Dreams -

  • yukari orihara censoredcreampiemature womanEUUDcenter villageshibuyajurakuEUUD-034EUUD034h-086euud00034
    • 2021-01-11
    81 min

    259LUXU-1367 Luxury TV 1351 As a business owner, as a mother with children … A little stimulating play with fire in your busy days … I want to forget my family only today and be disturbed by my desires! It is a must-see for a beautiful marr

  • amateur censoredbig titsmarried womanluxuluxu-1367luxu1367259luxu-1367
    • 2021-01-15
    160 min

    [MDBK-151]What a Coincidence! The Hooker They Sent Me Was the Girl I Jerked off to in High School! Cumming Ensues!! 5

  • nanase mona yuri fukada censoredcreampieschoolgirlMDBKbazookak taroMDBK-151MDBK151h-1496mdbk00151
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-17
    114 min

    [DDOB-086]A Vile Mom's Max Cock Squeeze Reiko Kobayakawa

  • kobayakawa reiko censoredmature womanslutDDOBdogmatenunmy auntDDOB-086DDOB086ddob00086
    • 2021-01-24
    126 min

    [KIMU-015]Breaking In My Naughty Stepdaughter Ichika Matsumoto

  • ichika matsumoto censoredcreampiebeautiful girlKIMUavs collector shiroyukifresh babe avs collector sKIMU-015KIMU015kimu00015
    • 2021-02-01
    24 min

    FC2PPV 1668390 [First shot] [Video letter sent from wife working at Sugi ward office to husband] “You. Even a civil servant woman is disturbed” Air make-up + vaginal cum shot for live sex [Personal shooting] With high-quality ZIP

  • amateur uncensoredfc2
    • 2021-02-06
    118 min

    [ADN-290]Licking Hard: Father In Law's Desire 7 - Shihori Kotoi

  • shiori kotoi censoredsingle workdramaADNattackersnaotootona no dramaADN-290ADN290adn00290
    • 2021-02-11
    50 min

    [gerk-347]りほ姉ちゃん

  • amateur censoredcreampieamateurgerkgerk-347gerk347gerk-347
    • 2021-02-18
    70 min

    [SIROR-050]Rent-A-MILF - The Hidden Side Of Mature Wives Their Husbands Never See File. No. 50 -

  • censoredcreampiebig titsSIRORdispatched.comSIROR-050SIROR050h-1492siror00050
    • 2021-02-18
    47 min

    [GRMO-024]ホテル盗撮 取引先の女部長と、ふたりきりの肉欲快楽接待

  • censoredGRMOmura chblood clam abaloneGRMO-024GRMO024h-1534grmo00024
    • 2021-02-22
    130 min

    [BTIS-111]Beautiful Crossdressing Prostitute 8 - Akari

  • censoredBTISbeautiful boy publishing.companykamon seijoicross dressing sexy boyBTIS-111BTIS111btis00111
    • 2021-03-01

    FC2PPV 1707259 Amateur Gonzo 40

  • amateur uncensoredfc2
    • 2021-03-05
    121 min

    [TUE-110]複数の男たちに犯●れ続けるロ●ータ美少女映像集

  • censoredcreampiebeautiful girlTUEglayzteito ura eizouTUE-110TUE11012tue00110
    • 2021-03-05
    240 min

    [SOUD-031]College Girl Gets Naughty! Too Real Completely Private POV Collection!

  • censoredamateurbeautiful girlSOUDprestigestrongest chome chomeSOUD-031SOUD031118soud00031
    • 2021-03-06
    48 min

    371AHSHIRO-175 Yuki / Shinohara couple / Matsushima / Mizutani couple

  • amateur censoredbig titsamateurahshiroahshiro-175ahshiro175371ahshiro-175
    • 2021-03-13
    54 min

    H4610 ki210314 Mika Shigeno 23years old

  • amateur uncensoredh4610
    • 2021-03-26
    57 min

    510ELLO-004 [Rapid rise] There is a report of obedient Sase junior.

  • amateur censoredamateurbeautiful girlelloello-004ello004510ello-004
    • 2021-04-02
    121 min

    [SSIS-026]5 Shameful Days Being Fucked By My Father-in-Law It Started The Monday My Husband Left For A Business Trip Saki Okuda

  • saki okuda censoredsquirtingsingle workSSISs1 no 1 stylerokusaburo mishimaSSIS-026SSIS026ssis00026
    • 2021-04-10
    128 min

    [EKDV-659]Breaking In An Innocent New Maid... She's Too Obedient To Resist - She Starts Enjoying It And Going After Men All On Her Own, The Perfect Fuck Doll Ran Tsukishiro

  • ran tsukishiro yuna himekawa censoredcreampiehandjobEKDVcrystal eizoharuo miyafujie kissEKDV-659EKDV659ekdv00659
    • 2021-04-22
    53 min

    FC2PPV 1766066 Amazing body ❤️ Beautiful busty Miss Sakura is an out-of-store option in plain clothes ❤️ Please enjoy the power of natural beauty big tits to the fullest. Pururun boobs are rubbed and sucked and there is a purchase privilege

  • amateur uncensoredfc2
    • 2021-04-22
    56 min

    200GANA-2471 Seriously Nampa, first shot. 1624 Active JD who came to Shibuya for shopping … Hey, I arrived at the hotel and immediately forgave my body! I was really waiting for a pick-up! ？？ Sensitive omako is blamed and the whole body is jerky

  • amateur censoredsquirtingamateurganagana-2471gana2471200gana-2471
    • 2021-05-26
    83 min

    435MFC-109 [Small Devil-based Libido Monster JD] Slender and Shaved Saffle and Norinori Tipsy SEX ♪ Deriheru Preparation Technique Chi ○ Pogatchigachi ↑↑ The big cock is too comfortable to stop swinging and panting Excellent sensitivity by rolling! !

  • amateur censoredcreampieamateurmfcmfc-109mfc109435mfc-109
    • 2021-06-05
    136 min

    [PKPL-006]Dating A Wonderful Girl That Is OK With Creampies: 18 Years Old - An Unfussy Country Girl With A Hidden Bitch Side - Miona Kotoha

  • miona hori censoredcreampieschoolgirlPKPLfuck group and fun friends daydreamersPKPL-006PKPL006pkpl00006
    • 2021-06-24
    139 min

    [IESP-682]S********l Rin Miyazaki Takes 20 Loads in a Row Creampie

  • miyazaki rin censoredcreampieschoolgirlIESPie nergykiku riniespIESP-682IESP6821iesp00682
    • 2021-07-02
    62 min

    FC2PPV 1899662 [Personal shooting] 65th shooting ¥ Idol ¥ [Amateur video]

  • amateur uncensoredfc2
    • 2021-07-08
    123 min

    [ARM-996]Whispering "I Love You" While She Sucks My Delicious Cock.

  • yu kawakami morino morino nozomi haneda censoredblowjobslutARMaroma kikakukadowaki shigeoaromaARM-996ARM996arm00996
    • 2021-07-15
    59 min

    H0930 ki210715 Kirigaya 34years old

  • amateur uncensoredh0930
    • 2021-08-03
    41 min

    H0930 ki210803 Sakurako Higashi 29years old

  • amateur uncensoredh0930
    • 2021-08-14
    131 min

    [TIKB-118]Miyatan: A Devilish, Slutty Sucking Friend - Miyabi Midorikawa

  • midorikawa miyabi censoredcreampiebig titsTIKBchikichikiba gu mousozokuTIKB-118TIKB118tikb00118
    • 2021-08-24
    150 min

    [KUSE-026]Amateur Demands Her Favorite Dicks For A Blowjob Home Visit! Unexpected Creampie For First-time Sex？! Plenty Of Cum In This All Out Sex Fest On Camera. 7x Dicks, 12x Cum Shots, 11x Cum Swallowing! Minami Iroha

  • minami iroha censoredcreampieamateurKUSEsod createichinose kurumijoyuu no kuse ga sugoiKUSE-026KUSE0261kuse00026
    • 2021-08-29
    49 min

    229SCUTE-1125 Marina (24) S-Cute Squirting Love Black Hair Uniform Girl Sex

  • amateur censoredsquirtinguniformscutescute-1125scute1125229scute-1125
    • 2021-09-07
    129 min

    [KTRA-328]Beautiful Little Devil With A Shaved Pussy Shizuku"s Seductive Creampie Sex Vol.1 Step-Niece Edition Shizuku Asahi

  • shizuku asahi censoredcreampiebeautiful girlKTRAk tribeKTRA-328KTRA328
    • 2021-09-09
    132 min

    [SPRD-1456]Asking My Father-in-law To Make Me Pregnant Without Telling My Husband Hana Haruna

  • haruna hana censoredmature womansingle workSPRDtakara eizouhotate ikkanaleddinSPRD-1456SPRD145618sprd01456
    • 2021-09-11
    159 min

    [SUPA-593]Bright, Bubbly, Bouncy Babe With Big Tits. You"ll Want To Get Even Closer To Her Spectacular, Nut-Busting Body While She Fucks Hard For Extreme O-Faces! The Juxtaposition Of Sunny Innocence And Down And Dirty Sex Will Blow Your Load For

  • censoredcreampiebig titsSUPAs kyuu shiroutoSUPA-593SUPA593supa00593
    • 2021-09-17
    119 min

    [BLK-518]Lewd Girls At The Door! M Kun"s House Sudden Girl Delivery! Miyu Sakurahana

  • miyu sakuraka censoredcreampieblowjobBLKkira kirazampakira hosi kira black galBLK-518BLK518blk00518
    • 2021-09-30
    141 min

    [AARM-019]This Ex Gal Has Gotten 100 Guys Off In Her Past, Now She Brings Her Amazing Temptress Techniques To Give Full Satisfaction At Home By Opening A Sexy Masochistic Salon. Wakana Asamiya

  • wakana asamiya censoredhandjobsingle workAARMaroma kikakukadowaki shigeoaromaAARM-019AARM019aarm00019
    • 2021-10-01
    121 min

    [NNPJ-474]This Girl Expected To Get Fucked, But She Had An 8 P.M. Curfew I Took This College Girl Around Town And Made Lovey-Dovey Love To Her At A Love Hotel And Gave Her 6 Raw Fucks A College Girl Mei

  • censoredcreampiebeautiful girlNNPJnampa japanNNPJ-474NNPJ474nnpj00474
    • 2021-10-04
    69 min

    543TAXD-003 Nagi (Nagi Mamiya)

  • amateur censoredcreampieamateurtaxdtaxd-003taxd003543taxd-003
    • 2021-11-19
    67 min

    SNYZ-045 Rei-chan 2 (Usami Suzu)

  • amateur censoredbig titsamateursnyzsnyz-045snyz045snyz-045
    • 2021-11-19
    136 min

    [ROE-025]G-Cup Wife MONROE Exclusive 2nd Entertainer! Creampie Open Season! At The Height Of Summer, All Alone In My Apartment With My Beautiful Stepmom Rumi... 2 Nights, 3 Days In A Sweaty Creampie Visit!

  • rumi amano censoredcreampiebig titsROEmadonnaunicorn fukudamonroeROE-025ROE025roe00025



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download