g spot




FC2MILKSQTEHDKANACRMIDESPRDMVSDCHRVATIDHZGDMEYDWAAAABWHNDHUNTBAVSAAUKSAPODVENXWANZ

2021-01-14
114 min

[TOEN-037]Cucked In The Next Room - On An Overnight Business Trip My Hot Wife Fucked My Employee - She Took More Than Ten Of His Creampie Loads In An Endless Night Of Cheating Sex Nanami Mineta

  • nanami mineda censoredcreampiemature womanTOENcenter villageushio ginmomozonoTOEN-037TOEN037h-086toen00037
    • 2021-01-15
    119 min

    [MKMP-373]完全主観 極上おもてなし風俗4変化 星なこ

  • nako hoshi censoredblowjobbeautiful girlMKMPk m producetiger kosakaimillionMKMP-373MKMP37384mkmp00373
    • 2021-01-23
    56 min

    FC2PPV 1657060 [Uncensored / Individual shooting] Gonzo with a girl who is too sensitive and horny ♪ Shake your hips and cum ❤️❤️ Creampie in a beautiful beautiful man!

  • amateur uncensoredfc2
    • 2021-01-28
    35 min

    FC2PPV 1662551 [New 1700pt → 1300pt until February 4th] 45 years old, neat and systemic erogenous zone wife and Gonzo! I felt it with S ● X after a long time ♡ [High image quality]

  • amateur uncensoredfc2
    • 2021-02-10
    43 min

    FC2PPV 1680760 * Uncensored * Appearance * Sakura-chan’s endurance vaginal cum shot 2nd round in a row! !! Successful vaginal cum shot in uniform ♡ 1 month left until college graduation … I still want to go crazy with a cock ♡

  • amateur uncensoredfc2
    • 2021-02-12
    120 min

    [DASD-814]Total Focus: Transsexual Queen Yura Tenshi

  • angel yura censoredbeautiful girldeepthroatDASDdashajime yanaiDASD-814DASD814dasd00814
    • 2021-02-19
    233 min

    [BGN-062]Erotic Infinity - Bursting Past The Limit With H-Cup Boobs! Exclusive Debut! Yuka Yuizuki

  • yuzuki yuuka censoredbig titssquirtingBGNprestigemanhattan kimurabeginningBGN-062BGN062118bgn00062
    • 2021-02-22
    109 min

    [SPRBD-045]A Little Song About Love Ruka Inaba

  • censoredbig titsbeautiful girlSPRBDintec incSPRBD-045SPRBD045h-706sprbd00045
    • 2021-02-22
    73 min

    [SLRO-006]A Hostess I Met In Nagasaki Puts On A Show Barely Dressed! Himeka Saotome

  • amateur censoredbig titsbeautiful girlSLROcraneSLRO-006SLRO006
    • 2021-02-25
    119 min

    [MILK-105]Shared-Room-NTR With A Handsome Young Employee During Their Business Trip, She Became Prey To His Handsome Young Cock At The Business Hotel This Arrogant Lady Boss Was Trying To Get Pregnant, And Now She Was Having Orgasmic Creampie Sex All

  • yui kawagoe censoredbig titssingle workMILKmilkMILK-105MILK105h-1240milk00105
    • 2021-02-26
    79 min

    230OREC-706 Mirei

  • amateur censoredcreampiebig titsorecorec-706orec706230orec-706
    • 2021-03-05
    118 min

    [ONEZ-278](Totally POV) Instant Sucking, Quickie Sex! You Have A Pregnancy Fetish？ OK! A Shameful Maid Who's Ready To Impregnate Kanna Shiraishi

  • shiraishi plane censoredcreampieblowjobONEZprestigeonezONEZ-278ONEZ278118onez00278
    • 2021-03-06
    125 min

    [JUL-493]S******g Her Way To The Top With NTR Lust - A Dedicated Wife Is Supporting Her Beloved Husband With Horny Hospitality - Mayuka Kitagawa

  • mayuka kitagawa censoredbig titsmature womanJULmadonnajotaro tomiJUL-493JUL493jul00493
    • 2021-03-07
    119 min

    [HKD-133]Captivated By A Younger Guy's Body - Miyuki Tsubasa

  • miyuki tsubasa censoredmature womansingle workHKDrubysuke kato 6mama rubyHKD-133HKD133hkd00133
    • 2021-03-19
    150 min

    [SSIS-023]Amateur No. 1 Style Uta Hayano Porn Debut

  • hayano uta censoredbig titsbeautiful girlSSISs1 no 1 stylemon cSSIS-023SSIS023ssis00023
    • 2021-03-28
    76 min

    300MAAN-638 [The most erotic body in history x Human dying] Is your special skill eating fast？ !! Vacuum W blow job that sucks up with a serious suction power like a vacuum cleaner! !! Constricted beauty big breasts x fair-skinned pie bread! !! IR

  • amateur censoredcreampiebig titsmaanmaan-638maan638300maan-638
    • 2021-04-15
    103 min

    [BBTU-011]Titty Masochism She's Panting And Moaning In Ecstasy And Cumming Like Crazy With Her Colossal Tits Nene Tanaka

  • nene tanaka censoredbig titssingle workBBTUdogmatenunmy big titsBBTU-011BBTU011bbtu00011
    • 2021-04-24
    73 min

    FC2PPV 1784119 Rem-chan with beautiful legs-Ecchi edition-I’ll call the Demon King (stick) even if it’s not in a different world ♪ [Personal shooting]

  • amateur uncensoredfc2
    • 2021-05-01
    120 min

    [ADN-314]My Precious Girlfriend Of One Month Had Raw Sex With Our Playboy Older Classmate Who I Hate Tsumugi Akari

  • akari tsumugi censoredbeautiful girlsingle workADNattackerskitorune kawaguchiotona no dramaADN-314ADN314adn00314
    • 2021-05-21
    40 min

    359TYVM-157 Saffle Can’t Be Satisfied With Two People … Sex With A Beautiful President With A Lot Of Sexual Desire! !!

  • amateur censoredcreampiemarried womantyvmtyvm-157tyvm157359tyvm-157
    • 2021-05-27
    55 min

    358WITH-101 Mitsuki (20) S-Cute With Gonzo H with her too beautiful

  • amateur censoredcreampieamateurwithwith-101with101358with-101
    • 2021-06-05
    140 min

    [URKK-040]My Boobs Are Fondled And I'm Fucked Every Day By The Horny Landlord Next Door - Hina Shinjo

  • hina shinjo censoredbig titssingle workURKKunfinishedrolanda familiar breastURKK-040URKK040urkk00040
    • 2021-06-10
    124 min

    [FSDSS-237]For Six Days Old Men Take Turns Fucking The Big Titty Girl Next Door Who Spent Her Spring Break In The Countryside Masturbating All Day Sara Kamiki

  • sara kamiki censoredbig titsschoolgirlFSDSSfalenoichimon maetafaleno starFSDSS-237FSDSS2371fsdss00237
    • 2021-06-14
    63 min

    491TKWA-004 Yui

  • amateur censoredcreampieamateurtkwatkwa-004tkwa004491tkwa-004
    • 2021-06-17
    87 min

    413INST-131 [Celebrity idol / appearance] Real idol and secret personal photo session. When I put out the cock in a closed room, he sucked me! It was a filthy girl who started to stake out herself when she got caught up with a demon piston!

  • amateur censoredcreampieamateurinstinst-131inst131413inst-131
    • 2021-06-25
    121 min

    [MIAA-460]Substitute Pregnancy Wife - Beloved Stepdaughter Cums And Gets Pregnant While Fucking Stepfather - Rina Takase

  • rina takase censoredcreampieslutMIAAmoodyzhiromichi hoseeveryone s porn starMIAA-460MIAA460miaa00460
    • 2021-06-26
    141 min

    [JKSR-498]10:00 A.M. What Happened To School...Nana Nana Maeno

  • nana maeno censoredcreampieuniformJKSRbig morkalobockeyprink junkyJKSR-498JKSR49857jksr00498
    • 2021-07-08
    120 min

    [FSDSS-255]"I love my girl but I'm worried" Getting Horny When My Girl Seduces My Coworkers Like A Slut Hiyori Yoshioka

  • hiyori yoshioka censoredbeautiful girlslutFSDSSfalenorockfaleno starFSDSS-255FSDSS2551fsdss00255
    • 2021-07-09
    121 min

    [MIAA-465]On a Hot Spring Trip With My Nieces, We Go Into the Men's Bath Together, I was F***ed to Come 10 Times By Barely Legal Chicks Playing Pranks. Ichika Matsumoto Lala Kudo

  • ichika matsumoto lara kudo censoredcreampiebeautiful girlMIAAmoodyzeightminna no kikatanMIAA-465MIAA465miaa00465
    • 2021-07-09
    116 min

    [KAM-086]Amateur NTR post: I secretly filmed my brother's wife and fucked her. Filming her as I fucked her, I was excited by the body of my slutty sister-in-law and her big tits, and I gave her a massive creampie.

  • censoredcreampiebig titsKAMkarmamanji groupKAM-086KAM086kam00086
    • 2021-07-15
    21 min

    HEYZO 2567 Mari’s Amazing Hand Job – Mari Koizumi

  • mari koizumi uncensoredhandjobcumshotheyzo
    • 2021-07-17
    233 min

    [REXD-374]Right After She Calls Her Haters Virgins... This E-Girl Has One Show Up At Her House To Teach Her A Lesson!

  • censoredcreampieREXDredmanji groupREXD-374REXD374rexd00374
    • 2021-07-20
    119 min

    [NXG-364]Being Immediately Reverse Picked Up By 8 Super Lewd Mature Women

  • censoredblowjobmature womanNXGstar paradisenext groupNXG-364NXG364h-254nxg00364
    • 2021-07-24
    61 min

    519MAZOF-008 Manner Instructor 26 Years Old Calling Rui To The Hotel Gonzo Training Hands And Feet Band Demon Ikase Immediately Scaled Female Pig Blow Face Electric Ma Vibe Blame Hell Inserted Raw In Engagement ♀, Creampie Gori

  • amateur censoredcreampieamateurmazofmazof-008mazof008519mazof-008
    • 2021-08-01
    80 min

    200GANA-2535 Seriously Nampa, First Shot. 1670 A Beautiful Office Lady Who Has An Affair With Her Boss Always Has Dirty Underwear In Her Bag! The Climax Of Joy With A Mean Play That Tickles Her Temperamental Heart!

  • amateur censoredsquirtingamateurganagana-2535gana2535200gana-2535
    • 2021-08-12
    121 min

    [DLDSS-022]Situation Reversal! I Invited A Call Girl Over, But It Was My Annoying Boss. Ayaka Tomoda

  • ayaka tomoda censoredsingle workdramaDLDSSdahliajounetsu yakaraDLDSS-022DLDSS0221dldss00022
    • 2021-09-03
    110 min

    [ADN-342]The Uncontrollable Passion Of My Wife Who Lost Her Feelings Of Pleasure, Michiru Kujo

  • kujo michiru censoredsingle workdramaADNattackersnagira kenzootona no dramaADN-342ADN342adn00342
    • 2021-09-05
    35 min

    FC2PPV 2151561 [No Right] Namba High-Priced Assistance ⑬ * Succeeded In Local Mobile Shooting! (It Will Be 3900 After 3400 Until September 20th)

  • amateur uncensoredfc2
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-12
    80 min

    413INST-159 [4th Idol] Negotiations Immediately After The Announcement Sex [Skits] Out Raw Squirrel At An Individual Handshake Event With The Idol

  • amateur censoredcreampieuniforminstinst-159inst159413inst-159
    • 2021-09-13
    58 min

    328HMDN-407 [Individual, 60th Road] Big Breasts Sexual Intercourse With G Cup Mother’s Sister. Gonzo Out Her Aunt Who Had Been Getting Nui From The Dc Era

  • amateur censoredcreampiemarried womanhmdnhmdn-407hmdn407328hmdn-407
    • 2021-09-19
    96 min

    413INST-164 ● Leaked ● [Personal Shooting] [Secret Cosplay Photo Session] With An Active Female Announcer Forbidden Gonzo Video With Her

  • amateur censoredcreampieamateurinstinst-164inst164413inst-164
    • 2021-09-25
    178 min

    [GIGL-661]This Married Woman Dropped Her Guard That Night, And Now She Was Being Paid A Night Visit ... She Pretended To Be A****p, But Couldn"t Resist The Pleasure, And Kept On Cumming, Over And Over Again

  • censoredamateurGIGLgigolo jigoropermagigoloGIGL-661GIGL661gigl00661
    • 2021-10-01
    151 min

    [CAWD-293]"Never Should Have Made You Celibate!" Throw Out All The Rules And Script! All The Fucking You Could Ever Want. Hana Shirato And Meru Ito. Sexy Plan To Turn Them Into Horny Sluts.

  • ito meru white peach censoredcreampieslutCAWDkawaiiCAWD-293CAWD293cawd00293
    • 2021-10-11
    59 min

    [SHH-028]Cheating With My Wife Right There. Massage Parlor Offering A Calming Massage While Taking His Dick In For Ass Shaking Cowgirl And A Creampie Load For A Neat And Clean, But Secretly Lewd Gorgeous Esthetician.

  • censoredslutSHHnatural highkansukeSHH-028SHH0281shh00028
    • 2021-10-16
    134 min

    [USAG-038]Deep Orgasmic Pleasure Through Deep Pussy Full-On Fucking Rika-chan (22 Years Old) Tied Up Orgasms / Consecutive Ecstasy / C*ck Descents / Scream / Otaku Girls / Light Skin / Big Tits

  • censoredcreampiebig titsUSAGusagi mousozokuUSAG-038USAG038usag00038
    • 2021-10-22
    125 min

    [ZKWD-019]After School Cum Dumpster #19, Yuzu Saijo

  • saijo yuzu censoredcreampiebig titsZKWDtoyohikozarakiyasushiun kaiZKWD-019ZKWD019zkwd00019
    • 2021-11-06
    163 min

    [FLAV-283]HYPER FETISH High-legged Slutty Queen Hazuki Wakamiya

  • wakamiya censoredslutsingle workFLAVdigital arkdigital ark dejitarua kuFLAV-283FLAV283flav00283



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download