first anal




FC2NACRHUNTBONEZDTTSTARSSPRDVEMAMARASSNIMIDVMEYDAVSASHKDSANSSISROYDAPODFSDSSVENUBLK

2020-12-25
57 min

[CLO-109]Convulsions! Incontinence!! Shaking FUCK!!! KAORI

  • kaori censoredbig titsCLOchobitchchovicCLO-109CLO109h-1435clo00109
    • 2020-12-27
    137 min

    [KNMB-008]All Raw STYLE @ Tsumugi # Barely Legal With Pop Star Looks # Age 18 # Cheeky Girl # Her First Compensated Date # Horny Girl With Stained Panties # Cute Voice When She Cums Tsumugi Narita

  • narita tsumugi censoredcreampieschoolgirlKNMBfirst star100 raw styleKNMB-008KNMB008h-491knmb00008
    • 2021-01-06
    73 min

    FC2PPV 1634443 [Personal shooting / set sale] The body of a 43-year-old mature wife is full of brilliance after ripeness.

  • amateur uncensoredfc2
    • 2021-01-07
    60 min

    [AKDL-075]My First Lay Was With My Stepsister. Erika Arimura

  • eri arimura censoredcreampieslutAKDLaquinoriaquinoriaknrAKDL-075AKDL0751akdl00075
    • 2021-01-08
    73 min

    259LUXU-1364 Luxury TV 1350 God’s lower body receptionist! Big and tight buttocks and thighs! The angle that sways from behind is just superb! !! The high-pitched pant that leaks every time it shakes also invites excitement!

  • amateur censoredamateurluxuluxu-1364luxu1364259luxu-1364
    • 2021-01-16
    27 min

    FC2PPV 1647137 [Personal shooting] Realistic fair-skinned J ● and slender brown J ● with 4P continuous vaginal cum shot

  • amateur uncensoredfc2
    • 2021-01-17
    100 min

    [OMHD-003]A Collection Of Barely Legal Babes, Hooked Up And Ready To Go This Barely Legal Babe Can Feel Her Body Gradually Going Numb And Stiffening Up As She's Turned Into A Visual Specimen Ai Kawana

  • ai kawana censoredblowjobsingle workOMHDdogmamigiwa otaOMHD-003OMHD003omhd00003
    • 2021-01-24
    120 min

    [APNS-224]Breaking In A Rich Bitch - Made To Fuck For 30 Days Until She's Pregnant Natsu Tojo

  • natsu tojo censoredcreampiesingle workAPNSaurora project annexyukihiro nasuaurora project anexAPNS-224APNS224apns00224
    • 2021-01-29
    51 min

    490FAN-088 Kaori

  • amateur censoredbig titsmarried womanfanfan-088fan088490fan-088
    • 2021-01-31
    80 min

    [orex-242]あゆり

  • amateur censoredsquirtinguniformorexorex-242orex242orex-242
    • 2021-02-12
    152 min

    [MDBK-159]Super Closeup! Ultimate Tits Come Again And Again vol. 4

  • an sasakura yamamoto renka censoredbig titslingerieMDBKbazookataro kMDBK-159MDBK159h-1496mdbk00159
    • 2021-02-13
    121 min

    240TOKYO-412 Meru

  • amateur censoredamateurbeautiful girltokyotokyo-412tokyo412240tokyo-412
    • 2021-02-19
    60 min

    [PARATHD-3118]I Found Out That My Lady Boss Was Working As A Delivery Health Call Girl, So Now I Can Take Advantage And Get All The Free Sex I Could Ever Want (6) Workplace: Advertising Agency A Mean Chief Executive 39 Years Old

  • censoredbig titsamateurPARATHDparadise tvPARATHD-3118PARATHD3118parathd03118
    • 2021-03-03
    73 min

    326EVA-144 Drink a guarantee at the pool pick-up immediately Paco ☆ If you switch on, you will not know the ceiling! Suppress Mutsurisukebe, who is weak to push, with the power of gold ww

  • amateur censoredamateurevaeva-144eva144326eva-144
    • 2021-03-06
    102 min

    [SHKD-931]This Housewife Who Was Unfaithful While Trying For A Baby With Her Husband... What Does She Actually Hope For When She Does Become Pregnant？ Yuri Sasahara

  • yuri sasahara censoredcreampiesingle workSHKDattackersmitsukisharkSHKD-931SHKD931shkd00931
    • 2021-03-25
    60 min

    Caribbeancom 032521-001 Quick Shooting: The Best of Mika Aoki

  • mika aoki uncensoredcreampiecaribbeancom
    • 2021-03-26
    101 min

    [GNAX-048]This Neat And Clean Young Wife Was Getting Fucked By A Homeless Man Every Day, And She Struggled To Withstand His Awful Smell While Getting Banged, But In The End ... Natsu Tojo

  • natsu tojo censoredcreampiedeepthroatGNAXnagiranagira kenzoGNAX-048GNAX048h-1345gnax00048
    • 2021-03-26
    240 min

    [SIV-045]Amateur TV x PRESTIGE PREMIUM 42 Amateur Idols Filmed For The First Time As Part Of Their Part Time Jobs!

  • censoredbig titssquirtingSIVprestigeamateur tvSIV-045SIV045118siv00045
    • 2021-03-31
    47 min

    292MY-449 Rin Fujisaki

  • amateur censoredmarried womanamateurmymy-449my449292my-449
    • 2021-04-09
    160 min

    [JUFE-281]Story About Breaking In A S********l With Huge J-Cup Tits Who Ran Away From Her Home In The Countryside In Return For Money

  • censoredcreampiebig titsJUFEfitchJUFE-281JUFE281jufe00281
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-07
    124 min

    [DASD-861]Enjoying A Stepmom/Stepdaughter Together. The Girl You Fucked Decades Ago Now Has A Girl Of Her Own. Rin Kira Mao Kurata

  • kira rin kurata mao censoredcreampiebig titsDASDdaschinpo dazaiDASD-861DASD861dasd00861
    • 2021-05-25
    58 min

    Pacopacomama 052521_481 Please insert your dick into my pussy! Yukari Ayaka

  • amateur uncensoredpacopacomama
    • 2021-06-06
    51 min

    188HINT-0461 Misaki

  • amateur censoredcreampiebig titshinthint-0461hint0461188hint-0461
    • 2021-06-12
    145 min

    [MKMP-401]As An Abstinent Life That I Don't Want Continues With My Boyfriend, I Fell Into A Wild 10-ejaculation Play With My Wonderful Senior. Nako Hoshi

  • nako hoshi censoredcreampiebeautiful girlMKMPk m producegoemonmillionMKMP-401MKMP401mkmp00401
    • 2021-06-16
    120 min

    [TPPN-196]Incredible Beauties Are Ready For Glistening, Sweat-Drenched Sex! She's Ready To Fall For You Body And Soul - Prisoner Of Passion Pushed To Her Upper Limit

  • censoredblowjobTPPNteppanTPPN-196TPPN196tppn00196
    • 2021-06-19
    240 min

    [CJOB-089]Best Of Full Cleaning Blowjobs Where The Girls Keep On Sucking Even After You've Cum Over And Over

  • ichika matsumoto satoshi kuruki censoreduniformblowjobCJOBslut havenslut haven bestCJOB-089CJOB089cjob00089
    • 2021-06-25
    31 min

    FC2PPV 1886565 First shot! !! Limited number [Uncensored] Creampie twice to the most beautiful waitress I met at the family restaurant! !! (Feature film)

  • amateur uncensoredfc2
    • 2021-06-26
    120 min

    [JBJB-023]高身長女子vsおじさんチ●ポ 長い脚とねっとり舌技で中年ザーメン絞り取るよ～ 森日向子

  • hinako mori censoredbeautiful girlsingle workJBJBsharkjabujabu machiJBJB-023JBJB023h-687jbjb00023
    • 2021-07-02
    240 min

    [HUNTB-041]A World Where Sex Is Forbidden "You Want To Kiss？!" But In This World, Sex Itself Is Outlawed And Even Taking Your Mask Off Is Prosecuted As Indecent Exposure

  • censoredcreampieschoolgirlHUNTBhunterkorosukehhh groupHUNTB-041HUNTB041huntb00041
    • 2021-07-03
    54 min

    H4610 ki210704 Yuiko Matsui 26years old

  • amateur uncensoredh4610
    • 2021-07-05
    69 min

    493NAEN-066 [Back] Gonzo leaked from a former underground idol! Even if you cry, a fierce piston & a large amount of vaginal cum shot [Bonus 2nd round Gonzo video included Asahi Shizuku

  • amateur censoredamateurbeautiful girlnaennaen-066naen066493naen-066
    • 2021-08-07
    58 min

    FC2PPV 1967256 * Limited Time 2980⇒1980 ★ First Shot ☆ Overseas Study History ♥ High Deviation Value Talented Woman ♥ Beautiful Breasts Nice Body De M Metamorphosis ♥ Kaya-Chan 26 Years Old ☆ Elite Woman Is In Agony ♥ Deep Throating ♥ Raw Cock Is Thr

  • amateur uncensoredfc2
    • 2021-08-14
    124 min

    [ZOCM-002]The Story Of A Sex-Crazed Wife Who Wanted Sex All Day Aoi Nakashiro (pseudonym) Aged 30

  • nakagusuku censoredcreampiesingle workZOCMzokuzoku musume mousouzokutodozokuzoku musumeZOCM-002ZOCM002zocm00002
    • 2021-08-14
    120 min

    [KSBJ-153]A Strange Family Relationship Honoka Kimura

  • honoka kimura censoredcreampiemature womanKSBJksb kikaku emmanuellesakura ninKSBJ-153KSBJ153ksbj00153
    • 2021-08-26
    227 min

    [SW-794]"Let"s Share A Bath!" Cousin"s Step-sisters Who Teases Me Shows Their Big Tits Off In Our Bath Together! Dick Reacts In No Time To Fondling And Bathing Breasts. Keeping It Hidden And Trying Hard Not To Cum!

  • censoredbig titsSWswitchyocchanswitch hibinoSW-794SW7941sw00794
    • 2021-09-07
    480 min

    [KTRA-329]Precocity! Sex With My Younger Stepsister Who Has Big Tits, A Compilation Of 10 Girls, 8 Hours, 2-DVD Set

  • shiho egami airi sato censoredbig titsbeautiful girlKTRAke toraibuk tribeKTRA-329KTRA329h-094ktra00329
    • 2021-09-11
    133 min

    [CEAD-361]I Am A Pleasure-mad Nasty Maturbator 20 - Rin Kira

  • kira rin censoredmature womansingle workCEADserebu no tomoCEAD-361CEAD361cead00361
    • 2021-09-17
    47 min

    FC2PPV 2214569 * None * There Is An Appearance Scene * A Female User Living In Tohoku Has Contacted Me To Take A Picture …! Super Sensitive Constitution And Continuous Serious ♡ Beautiful Breasts G Cup Risa (23) Life’S First Gonzo ☆ Review

  • amateur uncensoredfc2
    • 2021-09-18
    115 min

    [BIJN-207]The Document. Instinct To Show Off Fully For Climaxing Sex. Pleasure Seeking Married Woman Breaks Boundaries For Quick Pounding Creampie Orgy. Yuri Sasahara

  • yuri sasahara censoredcreampiesingle workBIJNbijin majoBIJN-207BIJN207bijn00207
    • 2021-09-28
    49 min

    [ETQR-289][Delusional Subjectivity] You Can Do Whatever You Want To This Body Tsugumi G-cup

  • censoredcreampiebig titsETQRerotic timeETQR-289ETQR289etqr00289
    • 2021-10-22
    167 min

    [MISM-219]She Volunteers To Learn Her Limits. Masochism So Good That It Makes You Cry. Deep Throat Orgasms Nenne Ui

  • first love censoredbig titsdeepthroatMISMemumusume labmasaki naoMISM-219MISM219mism00219
    • 2021-11-05
    226 min

    [HUNTB-138]"I Always Wanted To Be A Public Toilet For Everyone To Use" Modest Girl From The Country Comes To Tokyo And Becomes The Center Of Attention In A Nerdy Group Of Guys, Leading Her To Become A Total Slut And Surround Herself In Dicks!

  • censoredblowjobHUNTBhunterspace nyan jirohhh groupHUNTB-138HUNTB138huntb00138
    • 2021-11-05
    119 min

    [SSIS-231]Younger Man Unable to Resist Tempting Posing of 8-Headed Beautiful-Legged Married Woman in Far Window After Moving Home! Marin Hinata

  • marin hinata censoredslutsingle workSSISs1 no 1 stylemaeda bungouSSIS-231SSIS231ssis00231
    • 2021-11-18
    20 min

    [111821-001]Pussy Encyclopedia: Hina Hodaka

  • hina hodaka uncensoredcaribbeancom
    • 2021-12-17
    123 min

    [FOCS-037]They Cancelled The Fireworks Festival!？ A POV Video, Filmed During A Double Seduction Massive Squirting Kanon Kanade Sensitive, Instantly Cumming Big Tits Mizuki Yayoi The Strongest, Double Beautiful Girl Four-Way Swapping Creampie Large Or

  • kanon kanon mizuki yayoi censoredcreampiebig titsFOCSabc mousouzokufocusFOCS-037FOCS037focs00037
    • 2021-12-18
    121 min

    [ZOCM-015]A Younger Female Boss Gets Out Of It On The Street And Makes Love To Her All Night Long In A Shared Hotel Room. Ema Asahou

  • chaoyang ema censoredcreampiebig titsZOCMthrilling girls the daydream tribetodothrilling girlsZOCM-015ZOCM015zocm00015
    • 2021-12-18
    245 min

    [KDMI-041]Perfect Clothes Amazing Suite

  • tsukasa nagano hamazaki mao censoredslutKDMImiluaida yumenoKDMI-041KDMI041kdmi00041



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download