business attire




FC2PPPDEBODAPODWANZROYDMILKCHRVJUFESHKDWAAAATIDCESDAWDSANAVSAIPXHDKAHZGDSDABLULU

2020-12-17
92 min

435MFC-064 Aimi

  • amateur censoredcreampiesquirtingmfcmfc-064mfc064435mfc-064
    • 2020-12-31
    102 min

    [ADN-285]Dual Cheating In A Shared Room - Nailed By The Boss I Trusted Hikari Kisaki

  • hikari hime censoredbig titssingle workADNattackerskinotona no dramaADN-285ADN285adn00285
    • 2021-01-05
    134 min

    [STARS-314]Clothed Shameful Submersion Totally Clothed And Secret Camera Angles Yuna Ogura

  • yuna ogura censoredschoolgirlsingle workSTARSsod createbacon tanakasod starSTARS-314STARS3141stars00314
    • 2021-01-08
    58 min

    FC2PPV 1636451 [No] Model-shaped lady Hina, 21 years old, is inserted in the mouth for a walk date ♡! !! 【selfie】

  • amateur uncensoredfc2
    • 2021-01-09
    27 min

    H4610 ki210109 Self Shot

  • amateur uncensoredh4610
    • 2021-01-14
    29 min

    FC2PPV 1644888 [No] The undiluted solution that co-starred with that princess … [Finally appeared alone! !! ] A lot of benefits! !! Thank you to all the fans. Please enjoy the moment of delight. 【first half】

  • amateur uncensoredfc2
    • 2021-01-15
    131 min

    [SKEJ-005]The Second Love Of Her Life!! Married Woman Falls For Pleasure - Ren

  • censoredmarried womanSKEJamateur time delusion groupSKEJ-005SKEJ005skej00005
    • 2021-02-07
    240 min

    [MMB-348]Head Over Heels For Curvy, Soft, Squishy, Bouncy Marshmallow Bodies - 4 Hours

  • kina shinozaki shizuka omori censoredcreampieMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-348MMB348mmb00348
    • 2021-02-12
    136 min

    [CHN-197]New: We Lend Out Amateur Girls. 95 (Pseudonym) Suzune Akimoto (Grocery Store Clerk) Age 20

  • akimoto suzune censoredanalslutCHNprestigemanhattan kimurataiCHN-197CHN197118chn00197
    • 2021-02-24
    76 min

    SWEET-052 Sakurasaku

  • amateur censoredschoolgirlamateursweetsweet-052sweet052sweet-052
    • 2021-03-23
    240 min

    [SHIC-205]Legendary Young Hottie Collection Amina-chan 4 Hours

  • censoredcreampiebeautiful girlSHICadolescence.comSHIC-205SHIC205h-839shic00205
    • 2021-03-30
    138 min

    [SDAB-174]You Worked So Hard Today. Come Home And Let Stepdaddy Spoil You. Nana Hayami

  • don t be quick censoredschoolgirlsingle workSDABsod createsuisei akaione s youthSDAB-174SDAB1741sdab00174
    • 2021-04-01
    239 min

    [MGR-2102]An All-Japan Sex Tour 4 Hours Kobe/Gotenba/Omiya/Chiba/Hakodate/Tokyo (Akasaka And Ikebukuro) We Had Lots Of Sex With Sexy And Cute Amateur Girls!

  • censoredamateurMGRtm createmomojirimangoMGR-2102MGR2102165mgr02102
    • 2021-04-08
    144 min

    [IESP-679]Asuka Momose - First Time Lesbian - I Fell In Love With My Cousin

  • momose asuka rumi tadami censoredschoolgirllesbianIESPienergykikuriniespIESP-679IESP6791iesp00679
    • 2021-04-14
    114 min

    [ARM-972]Close Up French Kissing X Slow Thigh Job

  • rion izumi kagami sara censoredARMaroma planningshigeo kadowakiaromaARM-972ARM972arm00972
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-01
    118 min

    [ADN-312]Forbidden Ravishment 6 The Too Young Step Mother Nanami Kawakami

  • kawakami nanami censoredsingle workdramaADNattackerssadao sadaokaotona no dramaADN-312ADN312adn00312
    • 2021-05-01
    124 min

    [NACR-422]Horny Stepmoms Shihori Endo

  • gloss hall shiori endo bookmark censoredcreampiemature womanNACRplanet plusdirector onanakuruNACR-422NACR422h-237nacr00422
    • 2021-05-07
    161 min

    [MIST-336]Private Titty Bar - I Got A Message From A Broke Hostess For A Secret Meeting Between Just The Two Of Us... She Offered Me Creampie Sex On The Sly Miu Arioka

  • arioka miu censoredcreampiebig titsMISTmr michirusaitaMIST-336MIST3361mist00336
    • 2021-05-07
    62 min

    [050721_001]おもてなし ～パイズリ上手な女たち～

  • amateur uncensored1pondo
    • 2021-06-15
    141 min

    [SDTH-007]She's Got A Boyfriend Now, But This G-Cup Slut Still Wants To Star In Her 2nd Porno. 2-Year Insurance Saleswoman Working In Koto, Tokyo, Miss Narumi Kawabata (Pseudonym, Age 24) - Sex With 6 Dicks Until The Last Train (6 Hours, 42 Minut

  • narumi kawabata censoredcreampiebig titsSDTHsod createichiro mamieromanceSDTH-007SDTH0071sdth00007
    • 2021-06-16
    134 min

    [ROYD-060]When I Got My First Girlfriend, We Used This Camera To Film So Many Wonderful Memories ... And Now, I'm Using It To Film My Scary Friend While He Fucks Her ... And All The While, I Have A Melancholy Erection, That Just Won't Stop ..

  • rio matsumoto censoredcreampiesingle workROYDroyalkawajirihhh groupROYD-060ROYD060royd00060
    • 2021-06-19
    140 min

    [DASD-881]The Cutie At My Part-Time Job Wants Somebody With A Bigger Dick. Rui Nanase

  • nanase rui censoredbeautiful girlsingle workDASDdascognac kaminoDASD-881DASD881dasd00881
    • 2021-06-23
    87 min

    435MFC-117 [S-class perfect body beauty] Sex appeal Munmun ♪ Metamorphosis service with her own lewd underwear & a glamorous body that can not be hidden I am very excited about the yukata etch! Instinctively bare rich SEX cum shot 2 consecutive ba

  • amateur censoredcreampiebig titsmfcmfc-117mfc117435mfc-117
    • 2021-06-26
    120 min

    [XVSR-599]A Prostitute Who Will Definitely Let You Give Her A Raw Creampie Mao Hamasaki

  • hamazaki mao censoredcreampiebig titsXVSRmax ak c takedacalenXVSR-599XVSR599xvsr00599
    • 2021-07-09
    84 min

    GALGAL-003 Hina

  • amateur censoredamateurslutgalgalgalgal-003galgal003galgal-003
    • 2021-07-17
    189 min

    [REXD-371]Fucked In Front Of My Boyfriend...Teacher On Patrol During The School Trip, "She Should Be Knocked Out, So There's No Way She'll Wake Up!"

  • censoredcreampieschoolgirlREXDredmanji groupREXD-371REXD371rexd00371
    • 2021-07-23
    121 min

    [VEC-487]I Seduced The Virgin Next Door With A Bra And Tiny Panties Akari Neo

  • akari neo censoredcreampiemature womanVECvenuskaniemegami venusVEC-487VEC487vec00487
    • 2021-08-13
    240 min

    [HUNTB-074]What Is Studying When I"m In A Sharehouse Full Of Cute College Girls With Big Tits And I Can Fuck Anyone I Want Anywhere I Like 2

  • censoredcreampieblowjobHUNTBhuntervolvo nakanohhh groupHUNTB-074HUNTB074huntb00074
    • 2021-08-20
    133 min

    [HZGD-195]My Ex-Girlfriend Got Married With My Best Friend, So I Stole Away Her Heart And Soul And Her Body With Kissing Creampie Pure Loving Sex Sakura Tsukino

  • tsukino sakura censoredcreampiesingle workHZGDhitodzuma hanazono gekijouzampaHZGD-195HZGD195h-1100hzgd00195
    • 2021-08-23
    106 min

    FC2PPV 2066648 First Shot ♥ ️ Complete Appearance ♥ ️ 164/46 Fair-Skinned Slender Beautiful Girl ♥ ️ Teenage Active Girl With Zero Male Experience Though Cute Like An Idol ○ Student Challenges Loss Of Virginity ♥ ️ The Moment When A Meat Stick Digs I

  • amateur uncensoredfc2
    • 2021-08-28
    241 min

    [SGSR-284]Always Fuckable! "Why Does This Always Happen？" Girls Who Just Got Dumped Are The Easiest Lays! Love Them And Leave Them! Made To Take Creampies! Cads Prey On Their Broken Hearts To Fuck And Chuck Lonely Women Special 4 Hours

  • censoredcreampieamateurSGSRbig mocalprosperitynew battle groupSGSR-284SGSR28457sgsr00284
    • 2021-08-31
    46 min

    292MY-475 Ishihara karen 1

  • amateur censoredmarried womanamateurmymy-475my475292my-475
    • 2021-09-09
    160 min

    [MIST-349]Nipple Insanity A Nipple Girl From Tokyo Who Can Control Your Pleasure And Make You Ejaculate, Squirt, And Dry Orgasm From Her Skilled Nipple Play Tsubaki Kato

  • kato camellia kaoru natsuki censoredsquirtingmature womanMISTmr michirumiyoshi rusherMIST-349MIST3491mist00349
    • 2021-10-01
    120 min

    [WAAA-103]Titty Fuck For A Girl In A Reverse Bunny Suit. She Made Me Ejaculate Like Crazy In Hell. JULIA

  • julia censoredcreampiebig titsWAAAwanz factoryWAAA-103WAAA103waaa00103
    • 2021-10-09
    135 min

    [CEAD-369]I am a Horny Masturbator Who is a Pleasure Fanatic, Vol. 22 Chisato Shoda

  • shota chisato censoredbig titsmature womanCEADserebu no tomoCEAD-369CEAD369cead00369
    • 2021-10-26
    50 min

    Caribbeancom 102621-001 A Widow Who Unexpectedly Felt The Unreasonable Brother-In-Law’s Way In Front Of Her Husband’s Deceased Mio Futaba

  • mio futaba uncensoredcreampiecaribbeancom
    • 2021-10-27
    32 min

    FC2PPV 2377360 Prefectural Ordinary Course ③ Weekly ○ First Gonzo With A Uniform Gal Having Sex

  • amateur uncensoredfc2
    • 2021-10-29
    115 min

    [MIDE-992]Five Days Living Together With Plain But Truly Carnivorous C***dhood Friend! Hana Kotone

  • kotoneka censoreduniformslutMIDEmoodyzmoodyz divaMIDE-992MIDE992mide00992
    • 2021-10-30
    55 min

    [HEYZO-2647]Yui Kisaragi My Porcelain Skin GF Gets Fucked By Neighbour Old Fart

  • yui kisaragi uncensoredcreampiehandjobheyzo
    • 2021-11-20
    140 min

    [BOKD-238]Prostate Stimulation And Cum Leaking Out Like Tokoroten SEX - Tsumugi Kashii

  • kashii tsumugi censoredcreampiesingle workBOKDwe re she malesdorikawaBOKD-238BOKD238bokd00238
    • 2021-12-09
    54 min

    FCP-058 [Delivery Only] Absolutely Subjective! !! Sperm Is Almost Exhausted! Super Feeling Good! !! Nipple Licking Handjob ＃ 6 (Natural Mizuki Hinata Rina Arisugawa Amane)

  • amateur censoredamateurbeautiful girlfcpfcp-058fcp058fcp-058
    • 2021-12-11
    61 min

    10musume 121121_01 The School Uniform: It Feels Too Good To Get Goose Bumps Keiko Udaka

  • amateur uncensored10musume
    • 2021-12-18
    75 min

    H4610 tk0049 Minami Hamajo 19years Old

  • amateur uncensoredh4610
    • 2022-01-07
    60 min

    [010722-001]Extremely erotic little devil masseur with sheer nipples

  • anri kizuki uncensoredcreampiecaribbeancom
    • 2022-01-09
    59 min

    10musume 010922_01 Big Sunglasses: The Vibration Of The Toy Causes The Sunglasses To Shift Satsuki Okabe

  • amateur uncensored10musume
    • 2022-01-14
    64 min

    417SRYA-016 [Yariman Gal X Ozashiki Oops Pub] Geki Kawa Shortcut Oops Pub Miss Great Advent! Uncle Todoroki W With Plenty Of Saliva Belokis & Nipple Messing Around After Insertion, Look Down And Vaginal Cum Shot At The Missionary Position Of Ichar

  • amateur censoredcreampieamateursryasrya-016srya016417srya-016
    • 2022-02-28
    85 min

    345SIMM-702 [Reading Notice] S-Class Gal K-Chan @ Nakano [Beautiful Legs / Long Boots / Miniskirt / Creampie] #Underwear Voyeur #Train Molester #Home Invasion #Sleep Rape (Mina Kitano)

  • amateur censoredcreampieamateursimmsimm-702simm702345simm-702



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download