bitch




FC2NACRSPRDSSISVENURBDMILKLULUMIAAATIDFSDSSMIDVHNDDTTAWDSHKDHDKASANROYDIPXNACX

2022-12-17
135 min

GVH-489 A Pleasure Dependent Woman Who Is Addicted To Women'S Customs And Can'T Get Out Of!!

  • censoredslutGVHglory questyumeno aidaGVH-489GVH489gvh00489
    • 2022-12-16
    120 min

    MIMK-109 A Genius Who Draws A Working Older Sister Erotic Salon Live-Action Version Of A Carnivorous Bitch! A Live-Action Adaptation Of A Masterpiece Sold Over 30,000 Copies By Circle Patriots!

  • censoredcreampieslutMIMKmoodyzhasami kukamankitsuMIMK-109MIMK109mimk00109
    • 2022-12-14
    64 min

    285ENDX-427 Multi Solicitation Girls Shameful Bitch Enrollment In Return Sex Pies Spear Escape!

  • amateur censoredcreampiesquirtingendxendx-427endx427285endx-427
    • 2022-12-14
    56 min

    285ENDX-424 A Multi-Woman Who Hits Lightly Cum Shot Sex Hidden Transformation Bitch Spear Escape!

  • amateur censoredcreampiesquirtingendxendx-424endx424285endx-424
    • 2022-12-14
    57 min

    285ENDX-423 #Multi-Solicited Woman #Looking Back Sex #Feeling Good Consecutive Shots #Super Sensitive Bitch #Creampie Spear Escape #Kansai Dialect

  • amateur censoredcreampiesquirtingendxendx-423endx423285endx-423
    • 2022-12-14
    59 min

    285ENDX-425 When I Asked A Woman Who Persistently Solicited Me For A Pillow Business… She Was A Hidden Bitch With A Premature Ejaculation Pussy! Creampie Spear Escape!

  • amateur censoredcreampiesquirtingendxendx-425endx425285endx-425
    • 2022-12-14
    106 min

    300NTK-806 [God Style OL Each Defeated! ! Instant Protein! ! Instant H Special Edition] [Slender Orthodox Beauty Bitch"s Full Paisen & Gal Beauty Junior OL Bitch"s Beautiful Breasts] [Both Are Discovered To Be Shaved Miracle Hairless Generati

  • olololsp censoredcreampieamateurntkntk-806ntk806300ntk-806
    • 2022-12-13
    73 min

    FC2PPV 3144243 ★ 1 Week Only ★ [Brain Bug Yariman ♡] Discovered On SNS De M Bitch-Chan 25 Years Old. As Soon As You Get In The Car, You’ll Be Masturbating And You’ll Start Masturbating Immediately. [cen]

  • amateur uncensored
    • 2022-12-11
    52 min

    FC2PPV 3143683 [Sister Donburi] Part2! One-On-One Photo Shoot With Sex-Loving Bitch Sister Miri-Chan, An Honor Student Raised By A Young Lady, Mako, A Nymphomaniac Who Makes Her University Debut And Sucks Cock In Front Of Her Little Sister [cen]

  • amateur uncensored
    • 2022-12-02
    125 min

    712INFC-011 Colossal Tits Gravure’s Secret Hobby Is Uncle Eating. Nasty Ma Ko Who Became A Tadaman Bitch And Was Addicted To Rubbing The I Cup And Spree Is Looking For Vaginal Cum Shot Sperm

  • amateur censoredcreampiebig titsinfcinfc-011infc011712infc-011
    • 2022-11-29
    67 min

    FC2PPV 3136602 [Decision To Leak Out For The First Time In P Life] Cute Baby Face └|Twin Tail Idol Class Face, God Slender Beautiful Breasts Nice Butt Beautiful Legs It’s Ok If You Negotiate To Shoot, But It’s A Bitch I’ve Seen, So I P

  • amateur uncensored
    • 2022-11-26
    53 min

    CRNX-089 [4K] Beware Of Gal Slutty Girls Who Want To Spear All You Can!? Reverse Naan Bringing In Sex Ichika Matsumoto

  • ichika matsumoto censoredcreampieslutCRNXcrystal picturecrystal nextCRNX-089CRNX089crnx00089
    • 2022-11-25
    71 min

    116NHVR-194 [Vr] J ○ Appeared In A Matching App Was A Man"s Daughter Bitch Who Licked Her Anal And Invited Cum Shot Chibitori

  • amateur censoredanaluniformnhvrnhvr-194nhvr194116nhvr-194
    • 2022-11-25
    63 min

    FC2PPV 3135466 Neat And Clean Bitch [Handshake Event Idol Leak] Otaku Kameko And ◢ Idol’s Secret Meeting Hotel Video Leaked Cosplay At An Incognito Hotel, Photo Session Idol Who Was Curious About The Erection Cock Aimed At And Gave A Handjob Is

  • amateur uncensored
    • 2022-11-24
    130 min

    368ICHK-014 Let"s Go! Innocent Hidden Bitch Top Decisive Battle! Black Hair Neat And Clean De M Actress Mahiro Ichiki & H Daichuki Cheerful Perverted Girl Ena Satsuki

  • amateur censoredcreampieamateurichkichk-014ichk014368ichk-014
    • 2022-11-22
    64 min

    FC2PPV 3133371 *Limited To One Week* [Endless Orgasmic Hell] S-Class Beautiful Face Trained De M Bitch Descends!! [cen]

  • amateur uncensored
    • 2022-11-22
    116 min

    300NTK-794 [Toh Yoko Bitch Beautiful Girl Hidden Busty Pien Beautiful Girl Gun Thrust Nampa! ! ] [Indecent Butt Pien System Beautiful Girl GET! ! ] [Continuous Ascension 2NN In Front Of A Beautiful Girl With A Beautiful Buttocks And A Hidden Busty Bi

  • nonosp censoredcreampieamateurntkntk-794ntk794300ntk-794
    • 2022-11-20
    106 min

    VNDS-3395 Vulgar And Rich Nipple Licking Hand Job Fellatio Tongue Ejaculation

  • sugioka emiko honami matsushima censoredVNDSstar paradisenext11VNDS-3395VNDS3395h-254vnds03395
    • 2022-11-19
    121 min

    459TEN-042 [Upper System! Minato-ku Bitch] Extra Preamble, Null Foreplay, Nothing! ! I"m Going Full Throttle, And I"m Going To Make An IT Advertising Sales Woman Who Is Too Beautiful! ! ! She Looks Like An Idol, A Kisser Who Wants To Be Licke

  • amateur censoredsquirtingamateurtenten-042ten042459ten-042
    • 2022-11-18
    200 min

    HUNTB-418 “Wouldn'T It Be Dangerous If My New Dad Or Mom Found Out? You Can'T Speak Out.” The Daughter Of The Remarriage Partner Is An Uncontrollable Girl ○ Raw Libido Monster! My Mother Will Find Out...

  • censoredcreampieschoolgirlHUNTBhunterborubo nakanohhh groupHUNTB-418HUNTB418huntb00418
    • 2022-07-02
    60 min

    FC2PPV 3009638 [Resale] Fucking ☆ Bitch With A Good Personality [Creampie To A Little Stupid Yariman Gal] First Shot / Individual Shooting All 60 Minutes [cen]

  • amateur uncensored
    • 2022-11-12
    125 min

    GVH-479 According To Rumors, The Busty J-Type In The Next Class Is A Bimbo Who Has Stayed In The Year And Seems To Let You Do It When You Stop By After School Mita Sakura

  • mita sakura censoredcreampieschoolgirlGVHglory questkimura hajimeGVH-479GVH479gvh00479
    • 2022-11-11
    145 min

    BANK-101 Vaginal Cum Shot Open-Air Hot Spring Bimbo Japan Representative! Dirty Big Boyne Older Sister

  • censoredcreampieBANKma ko ginkoutakechanBANK-101BANK101h-1495bank00101
    • 2022-11-05
    140 min

    EKDV-695 I Was Slutty By Her Older Sister... My Squirting Musou Big Breasts Blonde Galvich Sister And I Was Completely Addicted By Her Squirting Musou Over And Over Again While She Was Away. B Alice

  • otsu alice censoredsingle workEKDVcrystal eizoupearlrice sakagamie kissEKDV-695EKDV695ekdv00695
    • 2022-11-04
    120 min

    DASS-083 My Son Is A Libido Monster An Erection That Won'T Fit No Matter How Many Times He Ejaculates By A Former Yariman Counselor Hibiki Otsuki

  • otsuki sound censoredcreampiesingle workDASSdasmishima rokusaburoDASS-083DASS083dass00083
    • 2022-11-04
    100 min

    FC2PPV 3122259 [Hinomaru Training Report] Hinomaru’s Bitch Who Licks Anal, Expands Anus, And Inserts Three Meat Sticks Before A Date With Her Boyfriend. Going Out Is Kindness

  • amateur uncensored
    • 2022-11-04
    210 min

    HUNTB-406 A Runaway Boy Who Was Picked Up By His Sisters And Turned Into A Pet. The People Who Picked Me Up Were The Neighboring Yariman Sisters. “You Can Stay Home. With A Contract That Says “Don'T Refuse Sex Instead”

  • censoredcreampieHUNTBhunterkawajirihhh groupHUNTB-406HUNTB406huntb00406
    • 2022-11-01
    112 min

    HONB-237 Bitch

  • imai kaho matsumoto ichika censoredHONBmercury mercuryshodai shibuya tokubetsu tokkou honbuHONB-237HONB237h-1133honb237
    • 2022-10-29
    125 min

    GVH-475 The Sick Girl Is Maika Chan Who Lives Her Days Using Patience Juice From The Punch Line As Medicine

  • censoredcreampieslutGVHglory questkimura hajimeGVH-475GVH475gvh00475
    • 2022-10-29
    130 min

    GVH-474 Erika Ozaki, A Super Natural Onapet Who Has Sex As She Is Said To Be A Man Who Comes Up To Her, Even Though She Is Unapproachable

  • ozaki erika censoredcreampieslutGVHglory questkimura hajimeGVH-474GVH474gvh00474
    • 2022-10-28
    134 min

    DVRT-008 Big Sister Vs. Frigidity Brother Haru Ogawa

  • ogawa haru censoredcreampiesisterDVRTdeepstokyo boydeep s 2 storeDVRT-008DVRT008dvrt00008
    • 2022-10-28
    120 min

    MIAA-731 The Student Council President With A Modest Personality Is A Horny Big Guy! Expert Committee Boys Under The Umbrella Of The Student Council And School Saffle Impure Heterosexual Activities Kisaki Nana

  • kisaki nana censoredcreampieuniformMIAAmoodyzzack araiminna no kikatanMIAA-731MIAA731miaa00731
    • 2022-10-28
    165 min

    BANK-098 Slender Older Sister Who Loves Ji Po Spree Vulgarly In An Outdoor Hot Spring

  • censoredcreampieBANKma ko ginkoutakechanBANK-098BANK098h-1495bank00098
    • 2022-10-21
    220 min

    HUNTB-386 “Try Masturbating In My Skirt...” Dangerous Temptation Of A Talented Girl With Glasses! I Can'T Refuse, I Masturbate So That People Around Me Don'T Get Caught And Put A Lot Of Bukkake On Girls' Pants!

  • censoredcreampiebukkakeHUNTBhunterborubo nakanohhh groupHUNTB-386HUNTB386huntb00386
    • 2022-10-21
    150 min

    HUNTB-388 “My Old Man Got An Erection, But You'Re A Gingin!” I Refuse To Wear A Uniform! Mouth Is The Worst! But They Are Kind And Super Polite At Work! My Dad'S Caregiver Is Too Erotic Gal And I...

  • censoredHUNTBhuntermasanorihhh groupHUNTB-388HUNTB388huntb00388
    • 2022-10-21
    170 min

    HUNBL-113 Super Pis Seeding To The Cheeky Mako Of The Brat J ○ Who Lick An Adult, I Don'T Understand Vaginal Cum Shot

  • censoredcreampieschoolgirlHUNBLhuntermikkoro chanhhh groupHUNBL-113HUNBL113hunbl00113
    • 2022-10-21
    140 min

    HUNTB-387 I'M A Dull Person Who Goes To A Boys' School, But When I Get Home, I Live A Harem Life With My 5 Sisters-In-Law Every Day! 2 My Secrets I'Ll Never Tell My School Friends.

  • censoredcreampiesisterHUNTBhunterkonnyaku kannohhh groupHUNTB-387HUNTB387huntb00387
    • 2022-10-21
    210 min

    HUNTB-392 “Don'T Wait... I'M Going To Insert It! Just Rub It On And Be Patient!” Two People Alone In A Competitive Swimsuit Intercrural Sex With A Beautiful Ace From The Swimming Club In The Club Room! She Is The Ace Of The Super Popular Swimming Clu

  • censoredcreampieHUNTBhuntermorikihhh groupHUNTB-392HUNTB392huntb00392
    • 2022-10-15
    60 min

    324SRTD-0311 The Active Esthetician Who Serves Too Much To The Nominated Customer Was Too Bitch W

  • amateur censoredbig titsamateursrtdsrtd-0311srtd0311324srtd-0311
    • 2022-10-15
    142 min

    DDHZ-017 Belo Licking Big Yuki Rino

  • yuki rino censoredslutsingle workDDHZdogmatenunore no hitodzumaDDHZ-017DDHZ017ddhz00017
    • 2022-10-15
    125 min

    GVH-467 According To Rumors, The Busty J-Type In The Next Class Is A Bimbo Who Is A Proficient Bimbo Who Seems To Let You Do It When You Stop By After School, Tsukino Hina

  • hina tsukino censoredcreampieschoolgirlGVHglory questkimura hajimeGVH-467GVH467gvh00467
    • 2022-10-15
    135 min

    GVH-466 A Pleasure Dependent Woman Who Is Addicted To Women'S Manners And Can'T Get Out Of It!

  • censoredslutGVHglory questyumeno aidaGVH-466GVH466gvh00466
    • 2022-10-14
    146 min

    277DCV-158 Caligura File.05_don’t Be Fooled! This Is A Real AV Actress! "I Am The God Of Eroticism! I’ll Show You A Real Slut." Avdebut Works Are All Lies! After All, Everyone Is A Jari*N Bitch! ▼ Already God’s Realm! Brain Ali

  • amateur censoredbig titsamateurdcvdcv-158dcv158277dcv-158
    • 2022-10-14
    160 min

    BANK-097 Cum Inside Outdoor Hot Spring Fair-Skinned Half Constricted Busty Intelligent Nasty Older Sister

  • censoredcreampieBANKma ko ginkoutakechanBANK-097BANK097h-1495bank00097
    • 2022-10-14
    120 min

    BLK-609 Convenient Tadaman Dad Loves Frustrated Big And Raw Until Morning Pacopaco 12

  • censoredcreampieBLKkira kirakira hosi kira black galBLK-609BLK609blk00609
    • 2022-10-09
    50 min

    413INSTC-331 [Thank You Momo-Chan! ] Colossal Jcup Female College Student After NTR College Bitch Life Sex Leakage Lovey-Dovey Gonzo Individual Shooting With Older People Repeatedly Vaginal Cum Shot To Confirm Their Love! (Kurumi Momose)

  • amateur censoredcreampiebig titsinstcinstc-331instc331413instc-331
    • 2022-10-08
    128 min

    MKMP-483 Solicitation Of A Newcomer Pacifier By Yarisa Honorary Chairman Nanase Alice Who Gets All Members And Sperm

  • alice nanase censoredcreampiesingle workMKMPk m producekaorumillionMKMP-483MKMP483mkmp00483
    • 2022-10-07
    150 min

    TYSF-026 “Hey, Can I Insert It Here?” My Super Serious, Sober Eyeglass Sister-In-Law With Raccoon Dog Eyes Is Actually A Little Devil! Secretly Request Instant Sex While In A Long Skirt! Pounding Secretly And Continuously Without Getting Caught Right

  • florets censoredsistersingle workTYSFroyalborubo nakanohhh groupTYSF-026TYSF026tysf00026



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download