big ass




FC2MIDEDASDWAAAHNDVEMAPREDNATRDTTKBIJULCHRVDASDSANPPPDATIDAUKGWANZSPRDCJODAMBI

2023-06-03
120 min

YMDD-327 Rumors About A Married Woman On A Business Trip Fleshly Ripe Delivery That Misleads Men Pheromones Overflowing With Big Ass Pita Bread! Secret Part-time Job Of A Weak Fluffy G Cup Wife Hono Wakamiya

  • honoka wakamiya censoredcreampiesingle workYMDDmomotaro video publishingtake dyoung peachYMDD-327YMDD327ymdd00327
    • 2023-06-03
    160 min

    LULU-214 Pushed By The Sexual Provocation Of A Deca-ass Cabin Attendant Who Lives In The Neighborhood, When Young Immediately Erected, She Ejaculated Many Times With Butt Tech. Mizuki Yayoi

  • mizuki yayoi censoredcreampiesingle workLULUlunaticsluminaxLULU-214LULU214lulu00214
    • 2023-06-03
    160 min

    LULU-218 My Father"s Remarriage Suddenly Made A Namaiki Deca-ass Neo Gal J-kei Younger Sister Irritated Me With Panchira Provocation, So I Made A Virgin Immediately Saddle Preaching Piston Many Times And Made It Understand. Satsuki Ena

  • ena satsuki censoredcreampieschoolgirlLULUlunaticsvragmanLULU-218LULU218lulu00218
    • 2023-06-03
    170 min

    MMKZ-127 Black Gal"s Too Erotic Big Butt! ! Ranka

  • ranka censoredsingle workMMKZmarrionkojiro miyamotoirisMMKZ-127MMKZ127mmkz00127
    • 2023-06-02
    145 min

    DVEH-008 A Premature Ejaculation Virgin Grabs A Weakness And Drowns In Continuous Ejaculation, A Frustrated Beautiful Ass Married Woman Next Door Sumire Kurokawa

  • sumire kurokawa censoredcreampiesingle workDVEHdeepspearl father jrdeep s 3rd storeDVEH-008DVEH008dveh00008
    • 2023-06-02
    120 min

    MIAA-831 I Betrayed By The Big Ass Of A Gentle Mother-in-law Who Was Trying To Save Me Who Became A Garbage Room Father And Betrayed Immediately And Consecutive Vaginal Cum Shot! Sumire Kurokawa

  • sumire kurokawa censoredcreampiesingle workMIAAmoody strendy yamaguchieveryone s kikatanMIAA-831MIAA831miaa00831
    • 2023-06-02
    238 min

    DVDMS-962 Big Penis Immediately Saddle In The Pita Bread Ass Of Neighborhood Aunt! 7 Forcible Insertion And Stopping Teasing A Beautiful Married Woman Who Remembered The Sexual Desire Of A Female Who Was Forgotten By SEX With A Handsome Piston! "

  • censoredcreampieamateurDVDMSdeepstamao satodeep sDVDMS-962DVDMS962dvdms00962
    • 2023-06-02
    170 min

    MIDV-308 Sex Appealing Temptation Slut Helper Voluptuous Deca Butt And Plump Thighs Full Erection ○ Po Nursing Care Jinguji Nao

  • jinguji temple nao censoredcreampieslutMIDVmoody strendy yamaguchimoodyz divaMIDV-308MIDV308midv00308
    • 2023-05-26
    264 min

    SKMJ-390 Raw Anal Licked Big Ass New Mom Busy With Childcare Wife Smells Muremure Anal And Licks Anal And Gets Embarrassed Blush Orgasm! Ass Hole Convulsions Fully Exposed Creampie Intercourse SP

  • censoredanalcreampieSKMJblush girlxyzSKMJ-390SKMJ390h-1324skmj00390
    • 2023-05-26
    123 min

    BANK-124 Busty Married Woman Onsen Date Big Areola I Cup Dark Skin Big Ass Wife Mari 32 Years Old

  • censoredcreampieBANKmako bankplanetBANK-124BANK124h-1495bank00124
    • 2023-05-20
    155 min

    FLAV-325 Perverted Big Ass Athlete Is Our Sexual Desire Processing Meat Urinal Tall Megumi Buttocks And Thighs Heavy Weight! A Vulgar Sexual Desire Monster Seeking An Erection Cock Dripping With Sensitive Oma ○ Koguchogucho And Man Juice

  • censoredsquirtingFLAVdigital arckashimadigital arkFLAV-325FLAV325flav00325
    • 2023-05-20
    181 min

    KATU-115 Lewd Thighjob That Makes You Want To Pinch (3) 5 Lewd Miniskirt Sluts With Voluptuous Bodies!

  • censoredslutKATUkatsuo product delusion groupmaglowKATU-115KATU115katu00115
    • 2023-05-20
    192 min

    HMNF-077 Gonzo Trip Part.1 Kyoto/Shinjuku/Nagoya Go On

  • kozomi hoshinaka wakamiya censoredHMNFhmjmcompany matsuonon fictonHMNF-077HMNF077h-172hmnf00077
    • 2023-05-20
    160 min

    KATU-114 Muscular Athlete Body Perverted Activity Of A Busty Fighter

  • censoredslutKATUkatsuo product delusion groupmaglowKATU-114KATU114katu00114
    • 2023-05-19
    240 min

    CJOB-129 "I"m Already Out In The Middle~" 90 Deca-ass Piled Cowgirls! BEST

  • ichika matsumoto julia censoredcreampieslutCJOBslut havenslut haven bestCJOB-129CJOB129cjob00129
    • 2023-05-19
    170 min

    CJOD-386 Big Ass Older Sister Comes To A Slut Creampie OK Rejuvenated Asian Men"s Esthetic Alice Oto

  • otsu alice censoredcreampieslutCJODslut havenhiroharu osakiCJOD-386CJOD386cjod00386
    • 2023-05-19
    120 min

    JYMA-034 Bimbo Wife Who Has Sex With Her Husband"s Company Boss And Colleagues Cuckold Flesh Feeling Body Beautiful Big Ass Masochist Wife Big Breasts & Big Ass Blamed M Wife Hatsune Minori

  • hatsune minori censoredcreampiesingle workJYMAmilf is hard mature womanbuddha dgroupJYMA-034JYMA034jyma00034
    • 2023-05-19
    130 min

    HMN-390 Protein (Semen) Desires Unstoppable Deca-Ass Trainer Squeezed Many Shots At Stakeout Woman On Top Posture Chintre Chanyota

  • chanyota censoredcreampieslutHMNbookhimopan of joytoyHMN-390HMN390hmn00390
    • 2023-05-18
    250 min

    ABW-356 Kawai Asuna"s Ass. 3 Powerful Butt Angles [10 Minutes With Bonus Video Only For MGS]

  • amateur censoredbig titsamateurabwabw-356abw356abw-356
    • 2023-05-17
    81 min

    fc2-ppv 3336281 [Nothing] Big Ass Plump Busty Divorced Wife! Experienced Black Hap Bar Multipurpose Toilet! More Than 100 Experienced People! *Review Benefits/high Image Quality Ver FC2-PPV-3336281

  • amateur uncensoredmarried womanamateur
    • 2023-05-16
    88 min

    435MFCS-068 ["Indecent Puri Ass X De M" Masochistic Rookie Hostesses] Taking Out A Charming Okini Hostesses To The After-Sales Hotel In … ♪ A Masochist Who Wakes Up To A Hot Body With A*****l Intake! ! S******g & Neck Hard Play Ecstas

  • amateur censoredcreampiebig titsmfcsmfcs-068mfcs068435mfcs-068
    • 2023-05-15
    75 min

    fc2-ppv 3321801 A Teenage Student With A Plump And Beautiful Big Butt. A Fair-skinned And Peach-ass Soft-ass Imo Girl Is Too Sensitive And Unintentionally Ejaculates! 3 Consecutive Shots Of Unexpected Vaginal Cum Shot. FC2-PPV-3321801

  • amateur uncensoredcreampieuniform
    • 2023-05-13
    161 min

    MMKZ-126 Big Ass And Plump ♪ Hanayanagi Anna

  • hanayanagi anna censoredsingle workMMKZmarrionkojiro miyamotoirisMMKZ-126MMKZ126mmkz00126
    • 2023-05-13
    113 min

    MRHP-020 When I Was Watching Av At A High Volume, A Beautiful Woman With A Big Butt Who Lives In The House Next Door Rushed In To File A Complaint. A Horny Married Woman Is Horny With My Erect Dick And Sperm It Backwards! I'M Yayoi Zuki With Live Dil

  • mizuki yayoi censoredcreampiesingle workMRHPmrs emmanuelnortonmrs assMRHP-020MRHP020mrhp00020
    • 2023-05-13
    129 min

    KHIP-011 Reiwa Style Newcomer. In The Name Of Education, I Will Educate You On The Prices! Alice Otsu

  • otsu alice censoredcreampiesingle workKHIPprincess kaguya pt delusional familynortonkaguya hipKHIP-011KHIP011khip00011
    • 2023-05-13
    129 min

    MRHP-021 I Can'T Put Up With My Secretary Because She'S Too Good-Looking! Regardless Of Whether She'S A Married Woman Or Not, Call It A Presidential Order And Fuck Every Day!! Amahari Noai

  • ai tenharu censoredcreampiesingle workMRHPmrs emmanuelnortonmrs assMRHP-021MRHP021mrhp00021
    • 2023-05-13
    44 min

    598HMT-042 [Defeat A Beautiful Part-time Worker With A Big Ass And Easy Delivery With A Big Cock! ] Gonzo SEX Wearing A Full-body Fishnet Tights On A Beautiful Woman Whose Oil Buttocks Are Too Erotic In The Rear Cowgirl Position! [Part-time Jobber/De

  • amateur censoredamateurhmthmt-042hmt042598hmt-042
    • 2023-05-12
    150 min

    MIAA-847 Double Cheerleader With Wide Open Legs And A Soft Body Ass Licking Her Anal ~ Encouraging Student Sexual Activity Where You Get Slutty Asses ~ Hana Himesaki Misono Waka

  • himesaki hana misono waka censoredanalcreampieMIAAmoody scameleveryone s kikatanMIAA-847MIAA847miaa00847
    • 2023-05-11
    311 min

    SVMGM-009 If You Endure The Magic Mirror Hardboiled, There'S A Prize! If It Doesn'T Work, Get The Big Ass Off Right Away! Female Xxx Crab Crotch Facesitting Cunnilingus Challenge! Sensitive Chestnut Skin Is Peeled Off, Licked By Delodero, And Her Ton

  • censoredanalcreampieSVMGMsadistic villagenew kazi kazamamagic mirror sadistic villageSVMGM-009SVMGM0091svmgm00009
    • 2023-05-09
    60 min

    fc2-ppv 3306205 ※Limited Quantity For The First Time※ [Innocent Big Boob Girl] Too Lewd Body "Baby Face Big Tits" Female College Student Hinata 20 Years Old Ass Fetish Father And Raw Mating [Creampie & Facial] FC2-PPV-3306205

  • amateur uncensoredcreampieamateur
    • 2023-05-08
    61 min

    fc2-ppv 3301923 [No] [Gonzo 390] Mutchimuchi"s Big Butt Bitch Provokes With A Fleshy Body! A Gorgeous Double Feature Of Sudden Creampie FUCK And Relaxing Anal FUCK Creampie In Bed! *Review Bonus/high Image Quality Ver FC2-PPV-3301923

  • amateur uncensoredanalcreampie
    • 2023-05-06
    140 min

    FCDC-153 A Secretary With Colossal Breasts And A Big Ass Is A Perverted Slutty Slutty Woman Who Seduces Employees By Bumping Her Nipples

  • amu ohara censoredslutsingle workFCDCweekenderkashimaFCDC-153FCDC153fcdc00153
    • 2023-05-06
    119 min

    BASJ-006 Beautiful Mature Woman With A Big Ass Who Tames A Younger Masochist Man By Licking Her Ripe Anal Reiko Kobayakawa

  • kobayakawa reiko censoredanalsingle workBASJbaltan baltanaoi buttonlady s supperBASJ-006BASJ006basj00006
    • 2023-03-01
    60 min

    fc2-ppv 3194480 [Infinite Climax Gangimari!!] Demon Neck JD 21 Years Old. Uncle Hentai Trained De M Bitch-chan Rolls Gachiaheri In Front Of The Camera And Cums In Brain Bug Kimepaco!!

  • amateur uncensoredcreampie
    • 2023-05-06
    117 min

    USBA-062 The Young Wife With A Big Ass Short Cut Is The Best Friend Sasaki Sakawa With A Domaso Body Who Loves Cocks

  • sakikazu sasaki censoredUSBAavs collector sthin blade purpleavscollector sUSBA-062USBA062usba00062
    • 2023-05-06
    121 min

    DAVK-081 [Miraculous J-Cup Beautiful Big Breasts] My Perverted Boyfriend'S Ntr Hobby Lent To A Horny Man'S Over 100Cm Soft, Colossal Breasts, Titties, Ejaculation, Shaved Pussy-Pussy/Shaved Pussy/Pussy/Shaved Pussy-Ass Of A First-Seen Man

  • censoredbig titsuniformDAVKdoujin av club delusion tribeyaiba hashida takamitsuDAVK-081DAVK081davk00081
    • 2023-05-06
    132 min

    KHIP-010 My Niece, Who Came To My House Due To Poor Behavior, Couldn'T Put Up With Momojiri Peeking Out Of Her J-Miniskirt, And When She Attacked Me, She Unexpectedly Honestly Made Me Do It And Creampied Every Day Since Then! Hiizumi Maika

  • maika hizumi censoredcreampieuniformKHIPprincess kaguya pt delusional familynortonkaguya hipKHIP-010KHIP010khip00010
    • 2023-05-05
    36 min

    fc2-ppv 3298231 [None] 500pt (Whip Whip I Met On The App ** I Persuaded A Bimbo Girl To Take A Picture And Cum Without Permission!) * Review Benefits / High Image Quality Ver FC2-PPV-3298231

  • amateur uncensoredcreampieamateur
    • 2023-05-05
    48 min

    MFTH-006 Seduction Type! Take A Man As A Beanbag! Little Devil Rikke Onna Rolls Her Cock With The Palms Of Her Hand! Stick Out Your Big Ass, Play With Chestnuts, And Suck On Your Cock! Exploit Semen By Swearing For Sperm As Research Material! [Biolog

  • censoredcreampieschoolgirlMFTHworks faleno tubedazai chinpoMFTH-006MFTH0061mfth00006
    • 2023-05-01
    152 min

    DOKS-576 Beautiful Woman With Nice Butts And Big Butts Pistons Pistons Masturbating With Dildos 3

  • ikuta town yuki rino censoredslutDOKSoffice k smatsumoto chrysalisDOKS-576DOKS57636doks00576
    • 2023-04-30
    120 min

    SAN-115 Big Breasted Wife With A Big Ass Who Was Inspired By Her Husband And Has Changed Her Appearance And Personality, But Has Regained Her Innocence

  • otsu alice censoredsingle workdramaSANmotheryellow cherry vaseSAN-115SAN115h-796san00115
    • 2023-04-30
    61 min

    043023_001 Big Ass Teacher"s Forced Creampie Supplementary Lesson

  • amateur uncensoredcreampieblowjob
    • 2023-04-29
    146 min

    FUNK-020 I Couldn'T Put Up With J●'S Big Butt In Uniform And Had A Blast In School After School. Satsuki Mei Repeats Getting Creampied By Her Student Who Can'T Resist The Pleasures Of A Big Cock

  • satsuki mei censoredschoolgirlsingle workFUNKfuncity delusional familynagases wingfuncityFUNK-020FUNK020funk00020
    • 2023-04-29
    165 min

    MMKS-025 Soothing Service: Healing Big Butt Soap Girl Yu Kawakami

  • yu kawakami morino morino censoredsingle workMMKSmarrionkojiro miyamotoirisMMKS-025MMKS025mmks00025
    • 2023-04-29
    130 min

    YMDD-323 Explosive Wife, This Is The Royal Erotic Queen Of The Boobs! The Last Way Of A Beautiful Big Breasts Hairy Wife Who Wants To Be Satisfied Suzuki Mayu

  • suzuki mayu censoredsingle workYMDDmomotaro video publishingaceyoung peachYMDD-323YMDD323ymdd00323
    • 2023-04-28
    122 min

    HODV-21759 My Girlfriend'S Older Sister, Who Doesn'T Have A Lot Of Sexual Desire, Runs Wild With Her Plump Big Butt! I Was Slutty By Piling Up Pile All The Time, And It Went On Me! Taki Yuina

  • taki yuina censoredcreampieslutHODVh m pk c takedaHODV-21759HODV217595642hodv21759
    • 2023-04-28
    110 min

    529STCV-272 [Iki Tide Special Warning Issued] I"ve Never Seen Such A Tide! ! H-milk Blonde Gal In Bottomless Tide Tank Records The Highest Amount Of Precipitation Ever! ! ! Gouged Out By My Favorite Big Cock And A Massive Flood! Huge Breasts X Bi

  • amateur censoredcreampiebig titsstcvstcv-272stcv272529stcv-272
    • 2023-04-28
    240 min

    EMTH-072 Big Breasts A Must-See For Mature Woman Enthusiasts! Huge Ass! Plump! 10 Best Mothers

  • censoredcreampieslutEMTHkedo edoEMTH-072EMTH072h-1638emth00072



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download