3p




FC2NACRCJODBLKSTARSAMBISSISJUFEVEMAGMEMSPRDSHKDCAWDSQTEFSDSSAUKGGVHAWDONEZDASDIPX

2021-01-08
152 min

[MIST-325]Right On Her Ovulation Day! Baby-Making Sex Ed - Practicing Creampie Sex With My Private Tutor - Ichika Kasagi

  • kasagi ichika censoredsingle workMISTmr michirusaitaMIST-325MIST3251mist00325
    • 2021-01-08
    47 min

    230ORETD-828 Yamamoto-san

  • amateur censoredcreampieuniformoretdoretd-828oretd828oretd-828
    • 2021-01-09
    118 min

    [MIDE-872]While My Wife Was Away Visiting Her Parents For Three Days I Gave My Stepdaughter A Lifetime's Worth Of Fucking. Sakura Miura

  • minamata sakura censoredbig titssquirtingMIDEmoodyzdragon nishikawamoodyz divaMIDE-872MIDE872mide00872
    • 2021-01-15
    135 min

    [SCOP-702]I Was Reunited With The Cutest And Baddest Girl In School! She Made Fun Of Me For Being A Cherry Boy, But The Moment I Shoved My Dick Inside Her, She Spasmed And Orgasmed And I Treated Myself To A Creampie! 5

  • censoredcreampieamateurSCOPscoopkuwattimousouzokuSCOP-702SCOP702h-565scop00702
    • 2021-01-15
    94 min

    FC2PPV 1644949 980 yen! Non-chan training diary ① “Doujin AV debut” A neat cosplayer will scream to Ahea with naughty ♪! 21-year-old JD3 Non-chan who challenges shooting with bruises in a dangerous play even in private Chapter 1

  • amateur uncensoredfc2
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-18
    62 min

    [tkwa-152]ゆい＆ちはる

  • amateur censoredcreampieuniformtkwatkwa-152tkwa152tkwa-152
    • 2021-01-22
    14 min

    10musume 012221_01 Watch Me Masturbating Tomoyo Hashimoto

  • amateur uncensored10musume
    • 2021-01-27
    47 min

    326HGP-012 Demon Pis Fuck No Guard Hairless Mons Pubis! !! Lori! Miss Kyaba! Moreover, a married woman! ？？ A nipple licking cowgirl in a drunken state, a pleasure seeker who is disturbed! !! Creampie in a pie bread masterpiece that urges sperm! !!

  • amateur censoredmarried womanamateurhgphgp-012hgp012326hgp-012
    • 2021-02-02
    44 min

    FC2PPV 1668575 “Amateur shooting” Kansai reader model Saki-chan, 20 years old, 2nd time, I did it when I was absent (^^) /

  • amateur uncensoredfc2
    • 2021-02-12
    151 min

    [EBOD-803]119 Climaxes! 104 Spasms Of Ecstasy! 2300 mL Of Squirting! Slim, Beautiful Babe With Big Tits Who Works As A Nurse And Social Media Influencer Takes Her First Creampie & Raw Fuck - On Camera! Mikako Horiuchi

  • mikako horiuchi censoredcreampiebig titsEBODe bodymon cEBOD-803EBOD803ebod00803
    • 2021-02-12
    115 min

    [PARATHD-3117]Picking Up Girls On The Street "Please Show Us Your Shaved Pussy!" (3) - And Fuck Us If You Feel Like It

  • censoredamateurPARATHDparadise tvPARATHD-3117PARATHD3117parathd03117
    • 2021-02-13
    73 min

    383REIW-045 Aoki-san

  • amateur censoredcreampiebig titsreiwreiw-045reiw045383reiw-045
    • 2021-02-16
    137 min

    [SDDE-644]Room Boundaries x NTR - This Entire Family Is Mine To Do As I Please, Heh Heh Heh! -

  • yui hatano yurika censoredcreampiebig titsSDDEsod createryo inugamisenzSDDE-644SDDE6441sdde00644
    • 2021-02-18
    60 min

    345SIMM-610 A nympho sister who sleeps on her sister’s boyfriend.

  • amateur censoredcreampieamateursimmsimm-610simm610345simm-610
    • 2021-02-22
    116 min

    [AGAV-049]Beautiful Sly Slut And Her Perverted Old Man Sugar Daddy's Shocking Fetish Play On Full Display - Elena Takeda

  • elena takeda censoredcreampieblowjobAGAVsex agentyoshida great buddhaAGAV-049AGAV049agav00049
    • 2021-03-01
    85 min

    300MIUM-691 A tall beautiful leg OL and a skipping trip to walk around Meguro in the morning! The staff are nervous with the power of the beautiful eyes and the G cup ww Finally, the situation is reversed with SEX! !! I’ll decide on a beautiful

  • amateur censoredcreampiebig titsmiummium-691mium691300mium-691
    • 2021-03-02
    135 min

    [SDAB-168]This Naughty And Boyish Girl With A Sensual Body Is Twitching And Throbbing And Cumming Like A Cunt And Moaning And Wailing In Ecstasy Like A Wretched Bitch She's Wearing Her Uniform While Engaging In Oiled-Up Massage Sex Nana Hayami

  • don t be quick censoreduniformschoolgirlSDABsodkomatsu 17youthSDAB-168SDAB1681sdab00168
    • 2021-03-02
    73 min

    FC2PPV 1708762 First shot ❤️ Massive vaginal cum shot to a fair-skinned indoor busty girl with little experience ♪ [Personal shooting]

  • amateur uncensoredfc2
    • 2021-03-06
    158 min

    [SSIS-009]Deep Throat Training So Intense She's Bubbling With Drool And Teased To Within An Inch Of Her Life With Deep Pussy G-Spot Development That Fucks With Her Mind So Badly She Descends Into Squishy And Sloppy Orgasmic Sex Tsubasa Sannomiya

  • sannomiya tsubaki censoredbeautiful girlsingle workSSISs1 no 1 styleinaballSSIS-009SSIS009ssis00009
    • 2021-03-25
    210 min

    [PIYO-109](With Streaming-Only Bonus Footage) "Make Me Your Bride, Papa" A Stepdad's Strange Relationship With His Barely Legal Stepdaughter Leads To Creampie Sex

  • censoredcreampiePIYOhyokopiero daamaenboPIYO-109PIYO1091piyo00109
    • 2021-03-25
    135 min

    1Pondo 032521_001 Ryu Enami : Ryu Enami Special Edition

  • amateur uncensored1pondo
    • 2021-03-29
    72 min

    492JCHA-064 Guess Scrap And Beautiful Girl

  • amateur censoredamateurbeautiful girljchajcha-064jcha064492jcha-064
    • 2021-04-09
    240 min

    [KRU-114]Daydreams Of Super Slutty Wives Miniskirt Bulging Asses Panty Shots

  • censoredmarried womanKRUkarmagroupKRU-114KRU114kru00114
    • 2021-04-15
    128 min

    [MOPT-006]Long-Legged Stunner Teases Male Subs In Her Pantyhose, Jeans, And Knee-High Boots Renon Kanae

  • kanae lennon censoredanalslutMOPTm o paradisemo tightMOPT-006MOPT006mopt00006
    • 2021-05-09
    79 min

    200GANA-2481 Seriously Nampa, first shot. 1634 Discovered when walking around Shinjuku under the name of "beaten shop"! A transcendental beautiful leg girl who accumulates work stress! "The best way to relieve stress is SEX! ], And it com

  • amateur censoredbig titsamateurganagana-2481gana2481200gana-2481
    • 2021-05-18
    98 min

    376H-626 Bondage Innocent Uniform Girls ●● Squid With SEX! ＃ Saki ＃ 18 years old

  • amateur censoredcreampieuniformhh-626h626376h-626
    • 2021-05-20
    97 min

    [OFKU-181]Step Mother With A Huge Ass Visits From Iwaki...Fifty Something Stepmom Seiko Nagata

  • shigeko nagata censoredcreampiemature womanOFKUstar paradisemom railOFKU-181OFKU181h-254ofku00181
    • 2021-05-28
    153 min

    [MIFD-159]Amateur 20 Year Old I'm Having A Hard Time Being True To Myself Porn Debut Yuika Aoi

  • yuka aoi censoredbig titsbeautiful girlMIFDmoodyzusa pyonmoodyz freshMIFD-159MIFD159mifd00159
    • 2021-06-16
    125 min

    [GVH-246]Naughty Nurses Satomi Suzuki

  • satomi suzuki censoredcreampiegrandfatherGVHglory questham the mcGVH-246GVH24613gvh00246
    • 2021-06-24
    153 min

    [FSDSS-249]Full-Body Licking Stimulates Her Erogenous Zones - She Gets Fucked 3 Times And Takes A Cum Facial - Rin Natsuki

  • rin natsuki censoredbig titsbeautiful girlFSDSSfalenomaeda tomonorifaleno starFSDSS-249FSDSS2491fsdss00249
    • 2021-06-25
    120 min

    [WAAA-080]Eating Out The Best Mistress And The Best Slut Raw In This Sexual Affair - Ai Sayama

  • sayama love censoredcreampiebig titsWAAAwanz factorywanzWAAA-080WAAA080waaa00080
    • 2021-07-06
    80 min

    469G-647 Imadoki Girls’ Yen Exchange (Daddy Activity) Circumstances! Cherry Blossoms

  • amateur censoredcreampiebig titsgg-647g647469g-647
    • 2021-07-09
    149 min

    [IPX-688]Must-see Boys with Sensitive Nipples! Make-out Idol Nipple Treatment Anna Kami

  • anna kami censoredsluthandjobIPXidea pocketdishIPX-688IPX688ipx00688
    • 2021-07-24
    53 min

    C0930 ki210725 Eriko Otake 30years old

  • amateur uncensoredc0930
    • 2021-08-02
    113 min

    [AARM-005]Don"t You Really, Really Want To Come From Having Your Nipples Licked While You Enjoy A Panty Shot？

  • nana matsumoto narita tsumugi censoredblowjobslutAARMaroma kikakuhamu oujiaromaAARM-005AARM005aarm00005
    • 2021-08-13
    47 min

    FC2PPV 2019587 [God Work] The Result Of Renting The No. 1 Active Lady ◯ For One Day … [Part 1]

  • amateur uncensoredfc2
    • 2021-08-13
    118 min

    [SSIS-155]And Right Next To Me, My Stepmom Was Being Treated Too ... A Big Tits Sch**lgirl Was Getting Continuously Treated With Titty Sensuality-Awakening Skills That She Enjoyed So Much, She Couldn"t Even Squeal With Pleasure Aqua Yamazaki

  • mizuyama yamazaki censoredbig titsuniformSSISs1 no 1 styleoosaki hirokoujiSSIS-155SSIS155ssis00155
    • 2021-08-17
    63 min

    FC2PPV 2039283 * Limited To 3 Days 2980⇒1980 ★ First Shot ☆ G Cup Beauty Big Tits Sports Ero Body ♥ Apparel Clerk Makoto-Chan 24 Years Old ☆ Anal Beads Blame Rich Blowjob With Nasty Mouth ♥ Beautiful Big Tits Shaking Meat Bullet Battle ♥ Raw Vaginal

  • amateur uncensoredfc2
    • 2021-09-03
    149 min

    [CLUB-651]Sweaty Ex-gangster Housewife Has Filthy D***k-Fucking Trip With Her Younger Worker. Miss Nishimura, 36 Years Old.

  • censoredcreampiebig titsCLUBhentai shinshi kurabuCLUB-651CLUB651club00651
    • 2021-09-04
    43 min

    292MY-494 Kimura Nanami 2

  • amateur censoredcreampiebig titsmymy-494my494292my-494
    • 2021-09-20
    97 min

    [VNDS-3375]Pocket Pussy Saleswoman 23

  • sakisui ran yamabuki censoredblowjobmature womanVNDSstar paradisenext11VNDS-3375VNDS3375h-254vnds03375
    • 2021-09-24
    118 min

    [JYMA-014]This Bride Is Going On An Infidelity Spree With Her Husband"s Boss And Co-Workers A Beautiful Maso Bitch Married Woman With Big Tits And A Meaty Body Ready For Cuckold Fucking She Got Her Huge Tits Tweaked Until She Came Like The Maso H

  • tachibana mary censoredcreampiebig titsJYMAtsukuzuku onna wa tsurai yobuddha dgroupJYMA-014JYMA014jyma00014
    • 2021-10-09
    83 min

    300NTK-644 [W Beauty Bitch’s Summit Battle! !! Rocket Milk VS Purijiri Slender W Bitch Competition Big Orgy! !! ] Supreme VS Ultimate! !! Dochashiko Smashing Orgy 4P! !! Rocket Milk Gal And Slender Gal Of Course W Bitches! !! Betting The Pride O

  • amateur censoredcreampiebig titsntkntk-644ntk644300ntk-644
    • 2021-10-16
    240 min

    [AVSW-061]AIKA"s World, 4 Hours of Her BEST Stuff

  • aika censoredsingle workAVSWavsAVSW-061AVSW061avsw00061
    • 2021-10-21
    480 min

    [SDAB-197]青春時代 ベストコレクション"21 13名のデビュー初撮りSEX 2枚組8時間

  • amateur censoredSDABsodSDAB-197SDAB197
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-04
    95 min

    FC2PPV 2401268 A Cute JD. 19-Year-Old Color Black And White Hair Slender And Beautiful Breasts Perfect Girl! Although It Was Said That "Creampie Is Absolutely Useless", It Feels Too Good And Forced Vaginal Cum Shot! !! !!

  • amateur uncensoredfc2



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download