various occupations amateur high vision javcensored censored




FC2EBODCHRVGVHMEYDMARASQTENATRMILKAWDKBIATIDWANZPPPDRBDADNJULDASDMIAAWAAAHZGD

2020-10-31
150 min

[JUNY-028]College Girl Gets Hit On During Her Interview And Starts To Like It - Big Booty Sub Urara Yuki's Porn Debut

  • yuki urara censoredsingle workJUNYfitchnikuyokuJUNY-028JUNY028juny00028
    • 2020-11-01
    122 min

    [SQTE-339]A Hairy Beautiful Girl's Wet, Stuffy Panties - Kanon Kanade

  • kanon kanon censoredblowjobbeautiful girlSQTEs cuteSQTE-339SQTE339sqte00339
    • 2020-11-07
    47 min

    [oretd-791]ゆきのちゃん

  • amateur censoredcreampieuniformoretdoretd-791oretd791oretd-791
    • 2020-11-07
    125 min

    [lady-355]るり＆あゆ

  • amateur censoredbig titsamateurladylady-355lady355lady-355
    • 2020-11-13
    94 min

    SMUK-030 Kurumi 2

  • amateur censoredschoolgirlamateursmuksmuk-030smuk030smuk-030
    • 2020-11-19
    120 min

    [AQSH-060]MILF Tennis Club - Infidelity With With A Tennis Coach, Pounding Her Shaved Pussy Is More Satisfying Than Whacking Balls Around - Working Class Wife Chiharu Miyazawa

  • chiharu miyazawa censoredcreampiemature womanAQSHaquamall herowhite moleaquamallAQSH-060AQSH060aqsh00060
    • 2020-11-23
    51 min

    FC2PPV 1581246 ☆ First shot ☆ Complete appearance ☆ Exquisite blowjob while making a jubojubo sound ♥ E cup beauty big tits fair-skinned beautiful girl JD and Icharab SEX cum shot ♥ [With benefits]

  • amateur uncensoredfc2
    • 2020-11-26
    133 min

    [MOND-203]I'm With My Favorite Lady Boss Kasumi Ikeya

  • kazumi ikeya censoredmature womansingle workMONDtakara eizohotate ikkandaiichi housouMOND-203MOND20318mond00203
    • 2020-12-01
    35 min

    H0930 ki201201 Etsuko Kawashima 43years old

  • amateur uncensoredh0930
    • 2020-12-11
    66 min

    328HMDN-319 [Personal shooting] Thorough training to get pregnant with witch’s milk big butt JD that squeezes sperm! Massive squirting with foreign-made (secret) oil! !! Big Breasts Yussa Yusa Shaking Cowgirl is pierced at the back and dies and

  • amateur censoredcreampiesquirtinghmdnhmdn-319hmdn319328hmdn-319
    • 2020-12-18
    60 min

    Caribbeancom 121820-001 Double Penetration As Orgy Sena Kusunoki

  • sena kusunoki uncensoredanalcreampiecaribbeancom
    • 2021-01-04
    61 min

    1Pondo 010421_001 Model Collection: Ciel Hiiragi

  • amateur uncensored1pondo
    • 2021-01-08
    240 min

    [SVDVD-834]The Magic Mirror Number Bus Hard Boiled What's In The Box？ If You Can Identify 3 Barely Legal Summer Girl Exhibitionist Babes Who Like To Show Off Their Skin, You Win 100,000 Yen! Take The Quiz Challenge!! She's Secretly Squeezing

  • censoredcreampiesquirtingSVDVDsadistic villagenew kage kazamamagic mirror number sadistic villageSVDVD-834SVDVD8341svdvd00834
    • 2021-01-10
    122 min

    [BACN-022]POV Stepsiblings - Kinky, Twisted Stepbrother and Stepsister - Wan Horikita

  • horikita wan censoredcreampieblowjobBACNbaltandaibutsu yoshidacandyBACN-022BACN022bacn00022
    • 2021-01-13
    43 min

    FC2PPV 1643694 Until 16th [Individual] Mama’s mother of two children in volleyball. Commit her sweaty body after practice with a stick of another person more than the debt and dripping the juice of another person

  • amateur uncensoredfc2
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-22
    61 min

    407KAG-133 ○○ Committee Noisy! ？？ ○ A school teacher has fallen into a big dick! Exposing the picture to the reason jumping to the merciless hip swing and climax ww

  • amateur censoredbig titsamateurkagkag-133kag133407kag-133
    • 2021-01-22
    88 min

    [SS-013]Natural Beauty - Kana Mizuto

  • kobayakawa reiko aiba reika censoredcreampiebig titsSSplumSS-013SS01313ss00013
    • 2021-01-29
    200 min

    [ABW-051]Aesthetics Of A Facial 13 - Creamy Cum Dripping From The Faces Of Hot Babes! Rumina Yuki

  • yuki rumina censoredcosplaysingle workABWprestigeshimikkiabsolutely wonderfulABW-051ABW051118abw00051
    • 2021-01-31
    99 min

    [VEC-464]I Took A Hot Married Woman Home From Her Part-Time Job For Creampie Sex Honoka Tsujii

  • tsujii honoka censoredcreampiebig titsVECvenusbingo tamatsukamegami venusVEC-464VEC464vec00464
    • 2021-02-04
    97 min

    [REBD-530]Airi5 Secret vacation/ Airi Suzumura

  • suzumura airi censoredsingle workREBDrebeccakawaREBD-530REBD530h-346rebd00530
    • 2021-02-06
    240 min

    [HUNTA-947]A Forbidden Love Affair With Your Stepmom! "Please! We Don't Need Words, I Just Want You To Fuck Me Furiously! Go Ahead And Keep Fucking Me Until You Get Tired Of Fucking Me!" The Truth Is, I Began Dating My Stepmom...

  • censoredcreampieHUNTAhuntervolvo nakanohhh groupHUNTA-947HUNTA947hunta00947
    • 2021-02-11
    50 min

    [gerk-351]Rさん

  • amateur censoredcreampiebig titsgerkgerk-351gerk351gerk-351
    • 2021-03-05
    96 min

    FC2PPV 1712427 [No vaginal cum shot] Tied up with Rorikko Miu-chan ♡ Gorigori toys blamed for vaginal cum shot! 【selfie】

  • amateur uncensoredfc2
    • 2021-03-21
    120 min

    [MISM-198]She's Lifting Her Anal Ban A Massive Chrysanthemum In Full Bloom Himari Nanase

  • himari nanase censoredanalsingle workMISMm girls labinaballMISM-198MISM198mism00198
    • 2021-03-24
    52 min

    444KING-030 Nanami (21)

  • amateur censoredcreampiebig titskingking-030king030444king-030
    • 2021-03-28
    56 min

    230OREX-234 Monami (I Cup)

  • amateur censoredcreampiebig titsorexorex-234orex234230orex-234
    • 2021-04-14
    168 min

    [ROYD-050]Is My Classmate From Back In School Now A Blowjob-Loving Nurse？! She Works The Night Shift - I Bumped Into Her Again At The Hospital And She Salivated For My Cock Miu Narumi

  • narumi miu censoredcreampieblowjobROYDroyalmorikihhh groupROYD-050ROYD050royd00050
    • 2021-04-23
    123 min

    [MIAA-428]This Real-Life Nurse Makes Men Cum In Bondage In Her Spare Time! Massive Loads Of Male Squirting - Tied Up And Ravished For Every Last Drop Of Seed By A Masterful Domme Slut Mikako Horiuchi, Age 23

  • mikako horiuchi censoredcreampieslutMIAAmoodyzmiyoshi rushereveryone s porn starMIAA-428MIAA428miaa00428
    • 2021-04-28
    55 min

    517MQXT-010 Enema Climax Daughter Who Explodes To The extent That It Goes Mad

  • amateur censoredanalamateurmqxtmqxt-010mqxt010517mqxt-010
    • 2021-04-29
    195 min

    [ABW-085]【MGSだけのおまけ映像付き 15分】女子マネージャーは、僕達の性処理ペット。 039 八掛うみ

  • amateur censoredamateurbukkakeabwabw-085abw085abw-085
    • 2021-05-01
    118 min

    [JUL-572]We're Inseparable - Lusty Stepmother/Stepson Bound By Their Mistakes - Ayaka Muto

  • ayaka muto censoredmature womanmomJULmadonnajotaro tomiJUL-572JUL572jul00572
    • 2021-05-02
    29 min

    FC2PPV 1798612 [Post a real record! ] In exchange for a large reward, a vaginal cum shot! Realistic ● Dating movie! !!

  • amateur uncensoredfc2
    • 2021-05-22
    14 min

    FC2PPV 1831470 When it becomes a blowjob class & practice table in the car, it feels too good and it feels good, and a large amount of cum swallowing → Cum ☆ 23-year-old gal Risa-chan

  • amateur uncensoredfc2
    • 2021-06-20
    240 min

    [NASH-528]Elegy For A Showa Wife - She Repays Her Husband's Loans With Her Body - Ravished By His Boss, His Lender, And Even A TV Reporter

  • censoredbig titsdramaNASHnadeshikocharlie miyazakiNASH-528NASH528nash00528
    • 2021-06-26
    111 min

    [VEMA-166]My Beautiful Female Teacher, Who Is My Homeroom Teacher, And Also Our Club Team Advisor, Is Also My Lover - Forbidden, Passionate, Creampie Sex, From Dusk 'Til Dawn, With My Older Girlfriend - Akari Neo

  • akari neo censoredcreampiebig titsVEMAvenuspetermegami venusVEMA-166VEMA166vema00166
    • 2021-07-02
    240 min

    [HUNTB-049]No Bra + Camisole + Plain Jane Step Sister With Hidden Huge Tits = It's Okay For Me To Suck On Her Boobs Until Her Nipples Show Through, Right？ Kind And Smart Step Sister That Came Into My Life When Our Parents Remarried

  • censoredcreampiebig titsHUNTBhuntercognac kaminohhh groupHUNTB-049HUNTB049huntb00049
    • 2021-07-02
    117 min

    [BF-636]Man Living Away From His Family For Work Gets Seduced By The Big Titty Neighbor And Fucks Her Hard Akari Niimura

  • akari shinmura censoredcreampiebig titsBFbefreeBF-636BF636bf00636
    • 2021-07-09
    189 min

    [MUDR-155]All it Takes are Fantasies to Get Me Wet... Beautiful Girl Desires Bondage and Training in Masochism. Ai Kawana.

  • ai kawana censoredcreampiebdsmMUDRmukuMUDR-155MUDR155mudr00155
    • 2021-07-14
    54 min

    494SIKA-097 A Natural Makeup Beautiful Girl Who Wants To See A Naughty Appearance 3P

  • amateur censoredschoolgirlamateursikasika-097sika097494sika-097
    • 2021-08-10
    44 min

    FC2PPV 1981146 [Hinomaru’S Midyear Gift 500p] I Couldn’T Forget The Magnum Cock And Remembered It Every Day And Masturbated. Gachinko Sex Of A Triple Three Upper Ball Girl With Beautiful Skin And Beautiful Breasts Spree On The Long-Sought M

  • amateur uncensoredfc2
    • 2021-08-13
    165 min

    [BANK-050]The Coed Gal Hot Spring Resort A Cheerful Horny Elder Sister Type With A Shaved Pussy And J-Cup Big Tits Who Loves To Do Sexy Things

  • censoredcreampiebig titsBANKma ko ginkoutakechanBANK-050BANK050h-1495bank00050
    • 2021-08-16
    60 min

    SIRO-4600 [First Shot] [Baby Face X Huge Breasts] [Extreme Fucking] Discovered A Talented Man Who Is Sure To Receive H Cup Huge Breasts On His Baby Face. If You Show Off A Fucking That Gently Wraps A Big Cock And Insert It Into A Tightly Wet Secret P

  • amateur censoredbig titsamateursirosiro-4600siro4600siro-4600
    • 2021-09-01
    75 min

    444KING-045 Yuzu

  • amateur censoredcreampiesquirtingkingking-045king045444king-045
    • 2021-09-02
    243 min

    [CVDX-462]Skinny Body But Soft And Firm Boobs! 30 Women, 4 Hours

  • censoredcreampiemature womanCVDXcenter villageCVDX-462CVDX462h-086cvdx00462
    • 2021-09-17
    230 min

    [HJMO-473]These neat and clean young wives don"t care if the neighbours are looking, they"ll play their cruel erotic mirror P****hment games with these huge cocks, and then have hot creampie sex! This young wife is coming back for seconds! 5

  • censoredcreampiemarried womanHJMOfirst planHJMO-473HJMO473hjmo00473
    • 2021-09-24
    205 min

    [HUNTB-102][What Are You Doing？! I Wanted My Girlfriend To Pop My Cherry!] A Perverted Younger Step-Sister Barging Into Her Step-Brother"s Room To Steal His Virginity

  • censoredcreampieschoolgirlHUNTBhunterborubo nakanohhh groupHUNTB-102HUNTB102huntb00102
    • 2021-10-08
    118 min

    [SSIS-207]Furious Follow-Up Piston-Pumping Strokes Until Her P*ssy Goes Insane! Sex With You, Fueled By Aphrodisiacs, To Pissing, Squirting, Dribbling Glory Kozue Fujita

  • kozue fujita censoredsquirtingsingle workSSISs1 no 1 stylemaeda bungouSSIS-207SSIS207ssis00207



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download