uniform amateur jav javcensored high vision




FC2VEMASSISMIDVAWDHNDHMNNACRFSDSSKSBJJULSTARSWANZHUNTBCHRVBLKAPODSQTEPPPDEBODHODV

2020-11-19
118 min

[SSNI-908]Detective Hotaru Goes Undercover At A Night Club And Ends Up G*******ged Hotaru Nogi

  • nogi firefly censoredbig titssingle workSSNIs1 no 1 styleamazing meatSSNI-908SSNI908ssni00908
    • 2020-11-27
    46 min

    [opcyn-122]うらら(24)

  • amateur censoredcreampieamateuropcynopcyn-122opcyn122opcyn-122
    • 2020-11-30
    59 min

    [mntj-038]ねね

  • amateur censoredbig titsamateurmntjmntj-038mntj038mntj-038
    • 2020-12-01
    99 min

    [SHMO-176]Venus Terme/Ryoko Maki

  • maki ryouko censoredsoloworkSHMOorustak softSHMO-176SHMO176
    • 2020-12-16
    134 min

    [MXGS-1163]She Used To Be My S*****t But She's Grown Into A Knock-Out Hottie - Nailing The Girl I Met At A Class Reunion From Dusk Till Dawn! Narumi Hirose

  • narumi hirose censoredbeautiful girlsingle workMXGSmaxingMXGS-1163MXGS1163h-068mxgs01163
    • 2020-12-18
    74 min

    [OTIM-049][Online Exclusive] [Daydream Re-Creation Drama] I Love Fugly Old Guys Hikaru Minazuki

  • hikaru minazuki censoredcreampieuniformOTIMprestigeonetimeOTIM-049OTIM049118otim00049
    • 2020-12-25
    486 min

    [GIGL-632]Un-, Unbelievable... I Can't Believe My 50-Year-Old Stepmother's Naked Body Is Making My Dick Hard... Our Single-Parent Household Is Far From Rich But I Treated My Stepmom To A Hot Springs Resort Trip To Thank Her For Diligently Rai

  • censoredmature womanmomGIGLgigolo gigolojun nagasawagigoloGIGL-632GIGL632h-860gigl00632
    • 2020-12-26

    C0930/H0930/H4610 ki201228 Amateur Organs

  • amateur uncensoredc0930
    • 2020-12-26
    61 min

    1Pondo 122620_001 Model Collection: Non Suzumiya

  • amateur uncensored1pondo
    • 2020-12-27
    120 min

    [AUKG-502]Me And My Classmate - Re: Matsuna & Chiharu - Lesbian S********ls Chiharu Sakurai Matsuna Koga

  • chiharu sakurai matsuna koga censoredschoolgirllesbianAUKGu krentoAUKG-502AUKG502aukg00502
    • 2021-01-24
    127 min

    [GENM-070]The Sequel: Breaking In A Trapped Babe At An Outdoor Warehouse Caught On Camera Rika Tsubaki

  • tsubaki rika censoredbig titssingle workGENMgenekig 3GENM-070GENM070genm00070
    • 2021-01-31
    155 min

    [LULU-053]Kisses So Deep They'll Make Your Whole Body Melt And Tongue Techniques Your Cock Will Get Rock Hard Before This Pale-Skinned, Busty Babe Makes You Blow Your Load Like Never Before Honoka Tsujii

  • tsujii honoka censoredcreampiebig titsLULUlunaticsvagmanLULU-053LULU053lulu00053
    • 2021-02-05
    28 min

    FC2PPV 1673526 Main story appearance Creampie in a beautiful campaign girl! Highleg x glossy pantyhose x stiletto heels Exquisite body and nice ass girlfriend in a pita pita leotard

  • amateur uncensoredfc2
    • 2021-02-12
    118 min

    [MEYD-656]I Am Actually Continuously Being Fucked By My Husband's Boss... Nozomi Higashi

  • nozomi higashi censoredcreampiesingle workMEYDtameike gorokazumaMEYD-656MEYD656meyd00656
    • 2021-02-19
    120 min

    [AQSH-065]Careless Wives On Skype - My Busty Neighbor Has Fallen Into My Trap... Hana Himesaki

  • himesaki hana censoredcreampiebig titsAQSHaquamall heroaquamallAQSH-065AQSH065aqsh00065
    • 2021-02-28
    56 min

    330PER-369 Mako 2

  • amateur censoredcreampiemarried womanperper-369per369330per-369
    • 2021-03-17
    50 min

    492MERC-288 Chemical Party Video

  • amateur censoredcreampieamateurmercmerc-288merc288492merc-288
    • 2021-03-29
    56 min

    492JCHA-042 Suddenly Decatin 3

  • amateur censoreduniformschoolgirljchajcha-042jcha042492jcha-042
    • 2021-04-01
    121 min

    [AMBI-123]Perverted Step Dad's Sex Toy Beautiful Y********l In Uniform Has Her Relationship With Her Boyfriend Ruined Suzu Monami

  • monami bell censoreduniformschoolgirlAMBIplanet plusdirector oanbibaresotsuAMBI-123AMBI123h-237ambi00123
    • 2021-04-07

    FC2PPV 1757191 Up to 11 [Appearance] Private general course ③ Creampie in big breasts who went on to specialize in voice actors of anime voice

  • amateur uncensoredfc2
    • 2021-04-13
    60 min

    299EWDX-354 A slender beautiful wife who is a reading model is friendly and likes SEX!

  • amateur censoredcreampiemarried womanewdxewdx-354ewdx354299ewdx-354
    • 2021-04-22
    110 min

    [MOND-214]With My Lovely Female Superior - Minori Junka

  • minori junoka censoredsingle workMONDtakara eizohotate ikkandaiichi housouMOND-214MOND21418mond00214
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-06-04
    63 min

    520SSK-003 Haruka

  • amateur censoredcreampieuniformsskssk-003ssk003520ssk-003
    • 2021-06-10
    77 min

    [IENF-145]Naughty Rejuvenating Massage - Busty Massage Parlor MILF Feels Guilty For Giving You An Erection, But Can't Resist The Temptation Of Riding Your Hard Cock

  • tsukishima sakura otsu alice censoredcreampiebig titsIENFienergyienfIENF-145IENF1451ienf00145
    • 2021-06-13
    77 min

    200GANA-2500 Seriously Nampa, first shot. 1648 Even though it’s so cute! A sad beautiful girl who was afraid to make a boyfriend because of the shock that her ex-boyfriend had an affair with her friend! It’s usually quiet, but when it comes

  • amateur censoredamateurbeautiful girlganagana-2500gana2500200gana-2500
    • 2021-06-19
    240 min

    [REXD-369]Stress Relief! Fat Burning! Dark Boxer Size. Now, Take A Deep Breath...

  • censoredcreampiebig titsREXDredmanji groupREXD-369REXD369rexd00369
    • 2021-06-20
    118 min

    [DBER-116]Cruel, Bizarre Sex Training - Ninjas - Female Ninja's Ass Broken In - Episode 2 - The Thousand Delights Of Paradise Rion Izumi

  • rion izumi censoredanalbdsmDBERbabyentertainmentkikubonred babeDBER-116DBER116dber00116
    • 2021-06-24
    120 min

    [HBAD-587]A Young Wife Innocently Seduces Men With Her Big Tits And Has Secret Adulterous Sex - Saeko Hiiragi

  • hiiragi saeko censoredbig titsblowjobHBADhibinoumanami jirobabeHBAD-587HBAD5871hbad00587
    • 2021-06-28
    113 min

    300MIUM-726 Rookie OL of Spill F Cup and Summer Trip to Odawara! Spear-filled ● This is too hot ● This is a rare outbreak on the verge of burns! !! Plenty of sperm injection into the back of the vagina that is too hot! !! The vaginal cum shot that do

  • amateur censoredcreampiesquirtingmiummium-726mium726300mium-726
    • 2021-07-04
    63 min

    300NTK-599 [Facial deviation value high] [G milk GAL] [Binkan convulsions constitution] This is NEO lewd! !! The reason for being moody is frustration and discovery! !! A large amount of sexual desire is spouted with love juice! !! Insert raw chin in

  • amateur censoredcreampiebig titsntkntk-599ntk599300ntk-599
    • 2021-07-09
    120 min

    [MIAA-470]I'm a masochist who got called on by my horny senior while sharing a room on a business trip. Kneading her nipples, I filled her up with creampies while she rode me cowgirl-style until the morning.

  • riho fujimori censoredcreampiebig titsMIAAmoodyzminna no kikatanMIAA-470MIAA470miaa00470
    • 2021-07-09
    147 min

    [MIFD-167]Debut of New 19 Year Old Open and Erotic Beauty With G-cup Tits, Who Grew Up in a Nudist Family Where No Bra, No Underwear Full Nudity Was Allowed!! Haruka Kishii

  • haruka kishii censoredbig titsbeautiful girlMIFDmoodyzusapyonmoodyz freshMIFD-167MIFD167mifd00167
    • 2021-07-10
    240 min

    [NKHB-005]My Sister-in-Law Is an M-cup, 173cm Tall, B133-W108-H123, Super Chubby Slut. A Special Extra-Large Serving of Rice Bowl. Sex 7 Times for Over 4 Hours.

  • censoredcreampiebig titsNKHBthick dining room mousouzokuNKHB-005NKHB005nkhb00005
    • 2021-08-18
    136 min

    [GVH-278]I Visited My Cousin For The First TIme In Years, And She Had Grown Some Colossal Tits, Riho Takahashi

  • riho takahashi censoredbig titssingle workGVHglory questhyonGVH-278GVH27813gvh00278
    • 2021-09-04
    32 min

    210AKO-437 Yuuki 2nd Shot

  • amateur censoredamateurakoako-437ako437210ako-437
    • 2021-09-16
    101 min

    [ZEAA-065]The Lewd Wife"s Intense Orgasmic Fucking, Hazuki Wakamiya

  • wakamiya censoredcreampiemarried womanZEAAcenter villagemurakithe pole center villageZEAA-065ZEAA065h-086zeaa00065
    • 2021-10-01
    120 min

    [HODV-21611]My Husband Doesn"t Ever Want To Fuck Me, Now My Terrible Younger CEO At Work Takes Me In For Dominant Sex. NTR Cheating Scenario. Mizuki Yayoi

  • mizuki yayoi censoredcreampiebig titsHODVh m pvotomsHODV-21611HODV216115642hodv21611
    • 2021-10-01
    117 min

    [MIAA-506]I Couldn"t Help Myself After My Provocative Stepsister Kept Showing Me Glimpses Of Her Panties, Starring Hana Shirato

  • white peach censoredcreampiebeautiful girlMIAAmoodyzdoragon nishikawaminna no kikatanMIAA-506MIAA506miaa00506
    • 2021-10-19
    16 min

    FC2PPV 2306887 [Personal Shooting] Miyabi 25 Years Old Blow & Handjob Remastered Version [Limited Time Offer]

  • amateur uncensoredfc2
    • 2021-10-20
    76 min

    259LUXU-1478 Luxury TV 1472 A Married Woman With A Strong Libido Who Talks About Having Sex As A Hobby Appears On Av With Her Husband’s Official Approval! The Plump Body Of A Woman Wears Annoyance And Freshness And Reacts Sensitively To Stimuli!

  • amateur censoredbig titsmarried womanluxuluxu-1478luxu1478259luxu-1478
    • 2021-10-30
    124 min

    [GVH-313]The Beautiful Teacher Who Fell Into the Den of Delinquent S*****ts. Mai Kagari

  • flower hunting censoredcreampiesingle workGVHglory questkimura hajimeGVH-313GVH313gvh00313
    • 2021-11-16
    45 min

    H0930 ki211116 Saeko Muramoto 32years old

  • amateur uncensoredh0930
    • 2021-11-23
    51 min

    FC2PPV 2457143 ~ 11/25 [Near The End] 50 Off For A Limited Time! !! [Appearance] [No Model] [Cusco] Superb ♪ 20-Year-Old Geki Kawa Active Reader Model ★ Sequel Sailor Cosplay

  • amateur uncensoredfc2
    • 2021-12-02
    114 min

    [AARM-038]Best Blowjob Where She Keeps Helmet In Mouth While Ferociously Slurping Rod Like a Tornado.

  • ikuta miku tsukishima sakura censoredblowjobhandjobAARMaroma kikakukadowaki shigeoaromaAARM-038AARM038aarm00038
    • 2021-12-02
    63 min

    FCP-056 [Delivery Only] "What Did You Do？ You Can Not Sleep？ I’ll Do Something Comfortable And Let You Lie Down … ”The Ultimate Healing Erotic! Co-Sleeping Handjob! !! ＃ 5 (Madoka Shizuki, Sachiko Kasumi)

  • amateur censoredbig titsamateurfcpfcp-056fcp056fcp-056
    • 2021-12-07
    51 min

    H4610 ki211207 Miki Sugino 24years old

  • amateur uncensoredh4610
    • 2021-12-10
    119 min

    [JUL-795]あんなに窮屈だった妻のアソコが、日に日に拡がっている…。 水戸かな

  • kana mito censoredmature womansingle workJULmadonnamametaro mamezawaJUL-795JUL795jul00795



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download