there hashimoto




FC2JULAWDWANZAUKSADNMVSDNATRCAWDVEMASQTEWAAADASDJUFENACXMEYDVENUHZGDROYDATIDSHKD

2018-01-25
227 min

[DANDY-586]"When You're Getting Private Tutoring By A Mature Woman And She Sees Your Hot And Hard Young Cock Won't Get Limp Even After Ejaculating, She Won't Be Able To Go Home Without A Fuck" vol. 3

  • censoredbig titsblowjobDANDYdandymargaret hashimotodandy soft on demandDANDY-586DANDY5861dandy00586
    • 2017-12-27
    146 min

    [SSNI-081]A Miniskirt Idol Watching Reflexology Salon Full Course Service With Secret Excessive Options Included Arina Hashimoto

  • there is hashimoto censoredsingle workSSNIs1 no 1 stylemon cSSNI-081SSNI081ssni00081
    • 2017-12-25
    121 min

    [NMO-020]Continued/ Abnormal Sex 50 Year Old Mother and Her Son -Miwako Hashimoto

  • miwako hashimoto censoredcreampiemilfNMOglobal media entertainmentyaguchineo momNMO-020NMO020143nmo00020
    • 2017-12-21
    199 min

    [DANDY-581]"I'm Over 40, And My First Creampie Partner Turned Out To Be My Niece" Since I Didn't Have A Condom, I Was Planning To Pull Out Before Cumming, But She Was So Good At Cowgirl Fucking That I Creampie Ejaculated Inside Her

  • censoredcreampieblowjobDANDYdandygarret hashimotoDANDY-581DANDY5811dandy00581
    • 2017-12-09
    120 min

    [JUY-336]Ever Since That Day When I Got My Pussy Pumped To The Deepest Depths Of My Life... Reika Hashimoto

  • reika hashimoto censoredmature womansingle workJUYmadonnakoyama masatsuguJUY-336JUY336juy00336
    • 2017-11-12
    119 min

    [JUY-303]My Husband Doesn't Know My Lusty Desires And My Secret Reika Hashimoto

  • reika hashimoto censoredmature womansingle workJUYmadonnakawaijou osamuJUY-303JUY303juy00303
    • 2017-11-12
    239 min

    [SSNI-056]S1 Brings You Their Top 2 Actresses In A Miraculous Beautiful Girl Double Massive Squirting Special 4 Hour Special Arina Hashimoto & Tsukasa Aoi

  • there is hashimoto tsukasa aoi censoredsquirtingbeautiful girlSSNIs1 no 1 stylezakku araiSSNI-056SSNI056ssni00056
    • 2017-11-02
    70 min

    [REBDB-260]Arina 3 The Absolute Unrivaled Idol! Arina Hashimoto

  • there is hashimoto censoredsingle workREBDBrebeccaREBDB-260REBDB260h-346rebdb00260
    • 2017-10-28
    150 min

    [SSNI-036]The Alluring Total Domain Schoolgirl Enjoy Miniskirt, Knee-High Socks, And Flashes Of Bare Legs Arina Hashimoto

  • there is hashimoto censoredschoolgirlsingle workSSNIs1 no 1 stylemonSSNI-036SSNI036ssni00036
    • 2017-10-27
    240 min

    [XRW-387]The Best First-Time Anal Sex 10 Girls 4 Hours

  • ai uehara shelly shelly shelley fujii censoredcreampieXRWk m producesugino kiXRW-387XRW387172xrw00387
    • 2017-10-14
    115 min

    [JUY-274]This Is My Identity In The Afternoon Reika Hashimoto Exclusive Video #3 Her First Drama!! <<Filth>> The Beautiful Face Of A Housewife In The Afternoon!!

  • reika hashimoto censoredmarried womanmature womanJUYmadonnaascension shiroJUY-274JUY274juy00274
    • 2017-10-05
    234 min

    [DANDY-572]"Why Aren't You Pumping Me When You've Already Got Your Dick Inside Me？" This Nurse Was Getting Hot And Horny With His Cock Inside Her... When He Grinds And Stirs His Dick Inside Her Pussy, She Starts To Cum Like Crazy! vol

  • censoredbig titsuniformDANDYdandymargaret hashimotoDANDY-572DANDY5721dandy00572
    • 2017-09-17
    145 min

    [JUY-248]A Madonna Exclusive Married Woman Is Experiencing 3 Real Orgasms For The First Time Ever Reika Hashimoto

  • reika hashimoto censoredmarried womanmature womanJUYmadonnamamezawa mametaroJUY-248JUY248juy00248
    • 2017-09-09
    154 min

    [SNIS-992]Schoolgirl Rough Sex Gang Bang Rape A Student Council President Targeted As A Cum Bucket Arina Hashimoto

  • there is hashimoto censoredsquirtingschoolgirlSNISs1 no 1 stylejo styleSNIS-992SNIS992snis00992
    • 2017-08-01
    299 min

    [DANDY-563]"Why Are You Getting An Old Lady Like Me So Excited？" A Camping Fuck Fest Special When An Old Lady Housewife Gets A Young Cock Shoved In Her Face, She Might Resist At First, But In Reality, She Wants To Brag About It To Her Mama Fr

  • censoredbig titsmature womanDANDYdandygarret hashimotoDANDY-563DANDY5631dandy00563
    • 2017-07-29
    160 min

    [SNIS-970]One Whole Day With My Favorite Dick - Make My Pussy Cum Hard, OK？ Arina Hashimoto

  • there is hashimoto censoredsquirtingbeautiful girlSNISs one number one stylexs1 no 1 styleSNIS-970SNIS970snis00970
    • 2017-07-20
    182 min

    [DANDY-561]"Please Don't Tease My Old Lady Nipples..." This Big Tits Private Tutor Was Refusing To Have Her Tits Fondled, But Her Erect Nipples Were Her Horny Switch, And Once That Switch Was Flipped, Over And Over, She Turned It On And S

  • censoredbig titsblowjobDANDYdandygarret hashimotoDANDY-561DANDY5611dandy00561
    • 2017-06-24
    146 min

    [SNIS-946]A Little Devil JK Who Lures Me To Temptation With Panty Shot Action Arina Hashimoto

  • there is hashimoto censoredschoolgirlbeautiful girlSNISs1 no 1 styletaro ryogokuSNIS-946SNIS946snis00946
    • 2017-05-14
    150 min

    [SNIS-923]Major Flooding! Violently Cumming, Squirting Orgasms Arina Hashimoto

  • there is hashimoto censoredsquirtingbeautiful girlSNISs1 no 1 stylekyoseiSNIS-923SNIS923snis00923
    • 2017-04-27
    479 min

    [OFJE-112]Arina Hashimoto: 1st Anniversary. Her Best-Of First Timers.

  • there is hashimoto censoredsquirtingcosplayOFJEs one number one styles1 no 1 styleOFJE-112OFJE112ofje00112
    • 2017-04-20
    196 min

    [DANDY-546]My Colleague Is A Married Woman, And When We Both Got Shitfaced Drunk One Night, She Was Sleeping While Exposing Some Panty Shot Action, So I Decided To Masturbate While She Slept, But Then She Caught Me, And Decided To Fuck Me vol. 1

  • censoredbig titsDANDYdandygarret hashimotoDANDY-546DANDY5461dandy00546
    • 2017-03-16
    227 min

    [SNIS-877]I Became So Dirty After Just One Year In This Special, We Bring You Bukkake And Arina In Grown Up Sex!! Arina Hashimoto A 1 Year Debut Anniversary

  • there is hashimoto censoredsquirtingbeautiful girlSNISs1 no 1 styleflagmanSNIS-877SNIS877snis00877
    • 2017-03-01
    40 min

    [030117_01]Emi Hashimoto

  • emi hashimoto uncensored10musume
    • 2017-02-18
    119 min

    [SNIS-854]An Ultra Quick Cock Sucking Maid Arina Hashimoto

  • there is hashimoto censoredbeautiful girlsingle workSNISs1 no 1 styletake dSNIS-854SNIS854snis00854
    • 2017-02-02
    180 min

    [DANDY-533]"Alone With A Part-timer Guy!" Part-timer MILF Doesn't Mind Getting Sexually Harassed By A Young, Good-looking Guy's Penis! vol. 3

  • censoredmature womanDANDYdandymargaret hashimotoDANDY-533DANDY5331dandy00533
    • 2017-01-28
    173 min

    [SNIS-830]Arina Hashimoto Gives Hot Smothering Kisses And Loving Blowjob Action

  • there is hashimoto censoredbeautiful girlsingle workSNISs1 no 1 styleusami tadanoriSNIS-830SNIS830snis00830
    • 2017-01-06
    228 min

    [DANDY-527]"Why Are You Getting An Old Lady Like Me So Excited？" An All Fuck All The Time Special This Old Nurse Is Saying She Doesn't Like It When We Shove Our Young Cocks Against Her, But We Know That She Wants To Brag That She Rode Our

  • censoredmature womannurseDANDYdandygarret hashimotoDANDY-527DANDY5271dandy00527
    • 2017-01-05
    60 min

    [REBDB-194]Arina 2 - Awakening! Only One Idol! Arina Hashimoto

  • there is hashimoto censoredbeautiful girlREBDBrebeccaREBDB-194REBDB194h-346rebdb00194
    • 2016-12-17
    119 min

    [SNIS-803]Jerk Yourself Off With This Cosplay Princess A Slender Cosplayer In 6 Cosplay Transformation Sex Scenes Arina Hashimoto

  • there is hashimoto censoredcosplaybeautiful girlSNISs1 no 1 stylezampaSNIS-803SNIS803snis00803
    • 2016-11-20
    119 min

    [SNIS-778]Let's Fuck Arina At School - Arina Hashimoto

  • there is hashimoto censoredschoolgirlbeautiful girlSNISs1 no 1 stylekyoseiSNIS-778SNIS778snis00778
    • 2016-11-10
    198 min

    [DANDY-519]"I'm Sorry, I Just Can't Forget The Thrill And Pleasure Of Being Harassed By The Molester" This Beautiful Girl Schoolgirl Always Gets On The Same Train At The Same Time To Be Molested By The Molester, And Although She Hates

  • censoredschoolgirlbeautiful girlDANDYdandygarret hashimotoDANDY-519DANDY5191dandy00519
    • 2016-11-01
    114 min

    [110116_01]Yuuka Nagata Mio Oikawa Saya Hashimoto Yuu Yoshinaka Miyuu Shimazaki Minami Akiyoshi

  • yuuka nagata mio oikawa uncensored10musume
    • 2016-10-15
    239 min

    [SNIS-755]Arina Hashimoto In Her Thrilling Sex Club First Experiences 8 Full Course Sex Service Experiences 240 Minutes

  • there is hashimoto censoredbeautiful girlsingle workSNISs1 no 1 styleichigoharaSNIS-755SNIS755snis00755
    • 2016-09-17
    119 min

    [SNIS-735]Shamefully Wetting Herself For The First Time Arina Hashimoto

  • there is hashimoto censoredsquirtingbeautiful girlSNISs1 no 1 stylekyouseiSNIS-735SNIS735snis00735
    • 2016-08-14
    148 min

    [SNIS-716]Stroll With A Schoolgirl, Arina Hashimoto

  • there is hashimoto censoredschoolgirlbeautiful girlSNISs1 no 1 styletakuanSNIS-716SNIS716snis00716
    • 2016-07-16
    118 min

    [SNIS-696]Mixed Body Fluids, Deep Sex Arina Hashimoto

  • there is hashimoto censoredbeautiful girlSNISs one number one stylecrests1 no 1 styleSNIS-696SNIS696snis00696
    • 2016-07-07
    63 min

    [REBDB-159]Arina - Bold, Extreme Pop Star! Arina Hashimoto

  • there is hashimoto censoredbeautiful girlREBDBrebeccaREBDB-159REBDB159h-346rebdb00159
    • 2016-07-07
    208 min

    [DANDY-500]"I Boarded A Crowded Bus And Pressed Myself So Hard Against The Tits Of A Housewife With A Baby Carriage Who Just Gave Birth So Her Nipples Were Still Sensually Sensitive, I'm Gonna Fuck Her Too" vol. 1

  • censoredbig titsDANDYdandymargaret hashimotoDANDY-500DANDY5001dandy00500
    • 2016-06-20
    51 min

    [k1332]Go Hunting!--- Yukari Hashimoto

  • amateur uncensoredcreampietokyo hot
    • 2016-06-18
    119 min

    [SNIS-679]Lovey-Dovey Everyday Life With Arina Who Loves Me So Much! Arina Hashimoto

  • there is hashimoto censoredbeautiful girlsingle workSNISs1 no 1 stylekyouseiSNIS-679SNIS679snis00679
    • 2016-05-15
    119 min

    [SNIS-662]First Orgasm! Her First Cum Facial And Threesome Arina Hashimoto

  • there is hashimoto censoredbeautiful girlsingle workSNISs1 no 1 stylekyoseiSNIS-662SNIS662snis00662
    • 2016-05-08
    150 min

    [MIRD-163]The Prince And His 10 Eternally Submissive Maids

  • kawamura maya ichika kamihata censoredMIRDmoodyzrakudaMIRD-163MIRD163mird00163
    • 2016-04-16
    149 min

    [SNIS-648]Ecstasy! For The First Time 6 Arina Will Show You All The Sex She Can Give You In This Special Edition Arina Hashimoto

  • there is hashimoto censoredbeautiful girlsingle workSNISs1 no 1 styleflagmanSNIS-648SNIS648snis00648
    • 2016-03-13
    148 min

    [SNIS-632]No. 1 Style Fresh Face Arina Hashimoto's Porn Debut

  • there is hashimoto censoredsquirtingbeautiful girlSNISs1 no 1 styleflagmanSNIS-632SNIS632snis00632
    • 2016-02-26
    89 min

    [n1129]Shaved Pussy Slave

  • miki hashimoto uncensoredcreampiebukkaketokyo hot
    • 2016-02-17
    64 min

    [BAGBD-055]Hidden Beauties Revolution Arina Hashimoto

  • there is hashimoto censoredbeautiful girlsingle workBAGBDbagusBAGBD-055BAGBD055h-305bagbd00055
    • 2016-01-29
    96 min

    [n1121]Big Boobs Acme Play

  • miki hashimoto uncensoredanalcreampietokyo hot
    • 2015-11-13
    240 min

    [MDB-655]Busty Female Doctors Only!! Mobile Creampie Mental Health Clinic

  • mayu satomi chiho hoshino censoredcreampiebig titsMDBmedia stationkoji fujinamibazookaMDB-655MDB65561mdb00655



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download