take away mousouzoku




FC2NACXHUNTBDASDSHKDAUKGMARAFSDSSSSNIWAAAADNPREDMVSDMILKABWCAWDSQTEMIDEMIDVAWDHZGD

2020-11-22
158 min

[MISM-186]She Demanded Gut Slams While She Wet Her Pussy She's Rolling Her Eyes To The Back Of Her Head In S&M Pleasure As I Throttled Her Deep Down Into Her Throat, She Released Her Maso Bitch Nature, And We Documented The Entire Journey For

  • censoredbeautiful girldeepthroatMISMm girls labtakuanMISM-186MISM186mism00186
    • 2020-12-10
    92 min

    [OKZ-014]Mature Goddess - Sex-Starved 40-Year-Old Woman Ryo Gets A Sexy Secret Part-Time Job Without Telling Her Family - Last Time She Had Sex Was Several Years Ago. Mature Married Woman On The Verge Of Exploding Due To Unfulfilled Desires Has A Sup

  • ryo fukutomi censoredcreampiemature womanOKZdaddy s private photosgodly mature womanOKZ-014OKZ0141okz00014
    • 2020-12-10
    240 min

    [HEZ-231]Wanna See How Ordinary Downtown MILFs Let Loose？ They Look Mature, But They Get Wild Like You'd Never Imagine In The Bedroom At The Chance For Orgasms Like They Used To - Passionate, Ecstatic Creampie Sex 3 16 Girls

  • censoredcreampiebig titsHEZhot entertainmentaunt chHEZ-231HEZ23159hez00231
    • 2020-12-18
    42 min

    FC2PPV 1609949 ■ Limited to 24 hours ■ Be careful of danger because you are too young. 18 year old nursing student. [Super bristle translation ant beautiful girl] Almost a virgin is first time. A miracle reappears while saying that the popular Anoko

  • amateur uncensoredfc2
    • 2020-12-20
    120 min

    [OFKU-169]The Bride's Mother Changing 3

  • ryoko sumida mikawa toki censoredblowjobmature womanOFKUstar paradisemom railOFKU-169OFKU169h-254ofku00169
    • 2020-12-21
    180 min

    [EYS-060]A Married Woman Is Secretly Filmed While She Indulges In Shame She's More Embarrassed To Be Wearing These Leotards Than If She Was Fully Nude, And Now She's Getting Raw Creampie Sex In Her Dripping Wet Pussy!

  • censoredcreampiebig titsEYSstudio i sEYS-060EYS060eys00060
    • 2021-01-12
    140 min

    [STARS-320]Sweatily Licking And Kissing The Body Of A Beautiful Girl - Mei Miyajima

  • mei miyajima censoreduniformhandjobSTARSsod creategoemonsod starSTARS-320STARS3201stars00320
    • 2021-01-16
    480 min

    [HHOY-007]"No... After All, I Have A Boyfriend..." An NTR Special! Highlights Of Girls Who Have Boyfriends, But Went With The Flow, And Ended Up Having Sex!

  • censoredHHOYoyashoku.companyhhh groupHHOY-007HHOY007hhoy00007
    • 2021-01-17
    243 min

    [KSBJ-113]Naked Wife Highlights vol. 5

  • yoshikawa aimi aya takashiro censoredbig titsmature womanKSBJksb kikaku emmanuelleKSBJ-113KSBJ113ksbj00113
    • 2021-01-20
    119 min

    [SPZ-1092]Cash For Pics - Beautiful Honor S*****t Is A Secret Slut With Blossoming Tits

  • censoredschoolgirlbeautiful girlSPZstar paradisestar paradiesSPZ-1092SPZ1092h-254spz01092
    • 2021-01-26
    124 min

    [SCPX-416]The Beautiful Girl Next Door Had A Fight With Her Boyfriend And Stormed Out Of The House In Her Underclothes. "It's Cold, Why Don't You Come In？" I Told Her, And Invited Her Into My Room, But When I Saw Her So Defenseless, W

  • censoredcreampiebig titsSCPXk m producehasshiscoop kmpSCPX-416SCPX416h-565scpx00416
    • 2021-01-27
    57 min

    230OREC-682 Konowa

  • amateur censoredcreampiebig titsorecorec-682orec682orec-682
    • 2021-02-13
    245 min

    [KDMI-032]Fucking Queen Amazing

  • maria nagai yuki god censoredcreampieKDMImiludopamixKDMI-032KDMI032kdmi00032
    • 2021-02-13
    119 min

    240TOKYO-411 Sayaka

  • amateur censoredanalbig titstokyotokyo-411tokyo411240tokyo-411
    • 2021-02-17
    65 min

    FC2PPV 1688037 [Problem work] Time stops from the beginning! Doujin original! All you want to do because it doesn’t move, if the ww time that you’ve been seeding your dreams moves, you’ll be pregnant with the rich sperm of a former vir

  • amateur uncensoredfc2
    • 2021-02-17
    54 min

    [sika-044]16番みーちゃん 2(18)

  • amateur censoredcreampieuniformsikasika-044sika044sika-044
    • 2021-02-22
    128 min

    [ANZD-064]She Looks Inexperienced, But... This Aggressive College Girl Actually Has A Nasty Habit Of Stealing Boyfriends And Eagerly Sucking Their Dicks And Letting Them Fuck Her Raw And Give Her A Creampie

  • censoredcreampieamateurANZDanzu daydream vacationanzuANZD-064ANZD064anzd00064
    • 2021-03-01
    48 min

    FC2PPV 1707347 [Personal shooting / Creampie] 33-year-old wife who wants to expose her proud body Thick semen released to the back of the body awakened by a toy

  • amateur uncensoredfc2
    • 2021-03-07
    120 min

    [KCDA-298]Mature Woman With Big Breasts And A Nasty Body Kyoko Maki

  • maki kyoko censoredbig titsblowjobKCDAdigital arkdigital ark digital arkKCDA-298KCDA298kcda00298
    • 2021-03-07
    100 min

    [VEC-468]When This Horny, Raging-Cock Husband Was Caught Committing Infidelity, His Wife's Best Friend Came Over To Lecture Him On His Wayward Ways Natsuki Takeuchi

  • natsuki takeuchi censoredcreampiemature womanVECvenuskaniemegami venusVEC-468VEC468vec00468
    • 2021-03-12
    243 min

    [UMSO-379]Secret Affair With Middle Aged Men POV Footage Of 10 Married Women Enjoying Fucking Around

  • censoredmarried womanamateurUMSOkm produceumanamiUMSO-379UMSO37984umso00379
    • 2021-03-15
    60 min

    SIRO-4458 [First shot] [Strike on the nice ass] [Honest body] A strange-aged woman with a naive shy smile. Her pretty girlfriend who is squirming in the atmosphere of her after a long time .. AV application on the net → AV experience shooting 1484

  • amateur censoredsquirtingamateursirosiro-4458siro4458siro-4458
    • 2021-04-09
    167 min

    [MIFD-153]I Want To Draw My Own Sex! Fresh Face Porn Debut - Cute & Boyish Mai Kagari, Age 20

  • flower hunting censoredbeautiful girlsingle workMIFDmoodyzusa pyonmoodyz freshMIFD-153MIFD153mifd00153
    • 2021-04-14
    146 min

    [PPPD-919]She Quietly Busts Her Patients' Nuts In The Middle Of Their Dental Treatments - Horny H-Cup Dental Hygienist's Porn Debut Yuno Homura

  • homura yune censoredbig titssingle workPPPDoppaiPPPD-919PPPD919pppd00919
    • 2021-05-10
    67 min

    326URF-058 [Back customs] [Four consecutive shots of angry waves] [Creampie in Reiwa’s nice ass princess] Fluffy loved BODY looks like an idol! However, the true nature is raw SEX that is watered down by a super gap of sperm madness! !!

  • amateur censoredcreampieamateururfurf-058urf058326urf-058
    • 2021-05-28
    107 min

    [YST-245]I Don't Care Whether It's Classy Or Dirty, I Just Want To Be Fucked By Miss Honma Until It Blows Yuri Honma

  • really censoredcreampiebig titsYSTkomyoYST-245YST245540yst00245
    • 2021-06-11
    145 min

    [IPX-678]Adultery Love - When I Creampied My Married Co-Worker - Nanami Misaki

  • nanami misaki censoredcreampiesingle workIPXidea pocketdishIPX-678IPX678ipx00678
    • 2021-06-11
    77 min

    [393OTIM-078]【妄想主観】排卵日子作りご奉仕メイド 横宮七海

  • amateur censoredcreampiebig titsotimotim-078otim078393otim-078
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-07-29
    25 min

    FC2PPV 1945098 [Uncensored] Umeda _ Freeter (I Gave A Vaginal Cum Shot To My Daughter Who Had Trouble Paying Due To Reduced Income In Corona)

  • amateur uncensoredfc2
    • 2021-07-30
    138 min

    [ATID-472]Midsummer Fuck: Anally Fucking My Daughter-in-law While My Wife Is Away Yui Kawagoe

  • yui kawagoe censoredanalsingle workATIDattackerstakuo ohtaniin madATID-472ATID472atid00472
    • 2021-08-20
    96 min

    [VNDS-3372]The Stepmom Who Pays A Night Visit To Her Stepson"s Apartment

  • censoredcreampiehandjobVNDSstar paradisenext11VNDS-3372VNDS3372h-254vnds03372
    • 2021-09-22
    50 min

    396BIG-113 Yuzu

  • amateur censoredcreampieschoolgirlbigbig-113big113396big-113
    • 2021-09-23
    109 min

    [IRO-045]Nipple Fondling Train Groper - Married Woman Gets Her Hard Nipples Pinched Relentlessly For Horny Excitement. Yukari Mikawa

  • yukari mikawa censoredcreampiemarried womanIROcenter villagejiro fukagawazora center villageIRO-045IRO045h-086iro00045
    • 2021-09-24
    199 min

    [HUNTB-101]"We"re Not Letting You Go To Sleep Yet!" - Two Sexy Female Bosses With Big Tits Trap Their Coworker In A Sex Sandwich And Fuck Him Until Morning! 2

  • censoredcreampieblowjobHUNTBhunterkonnyaku kannohhh groupHUNTB-101HUNTB101huntb00101
    • 2021-10-05
    88 min

    261ARA-509 [Cute Girl] [Seriously Beautiful] Mana-Chan Is Here! The University Is In A State Of Withdrawal Online … I Want To Get Rid Of It Since I Wanted To Meet People! !! Transcendental Cutie With Full-Blown Etch Aura ♪ [Transcendent Slender]

  • amateur censoredamateuraraara-509ara509261ara-509
    • 2021-10-06
    131 min

    [GVH-297]露出・輪●・ぶっかけ願望に憑りつかれた女 吉良りん

  • kira rin censoredslutsingle workGVHglory questusubashi suiGVH-297GVH297gvh00297
    • 2021-10-09
    242 min

    [UMSO-417]Nothing But Watching Girls Cleaning The House Naked, 24 Performers, Video Volume 04. Big Tits Maid Edition.

  • reina fujikawa rin shiraishi censoredbig titsUMSOk m produceumanamiUMSO-417UMSO417umso00417
    • 2021-10-30
    77 min

    300NTK-653 [Uncle Chin Geki Iki Beautiful Bomb Butt JD] [Job Hunting 3P Skillful Jiji Tech Geki Iki] Job Hunting JD Duo Who Will Give 3P To The End Of The Dirty Little Erotic Old Man! !! Erotic Curiosity Of Lewdness Confirmed From Jijii Squared Parad

  • amateur censoredcreampieamateurntkntk-653ntk653300ntk-653
    • 2021-11-06
    120 min

    [NASH-599]Working Mature Lesbian. Sweet Trap That Would Cause Any Woman To Become a Lesbian.

  • censoredlesbianmature womanNASHpinknadeshikoNASH-599NASH599nash00599
    • 2021-11-20
    49 min

    10musume 112021_01 BJ In Public Restroom: It’s Sudden, But Screw Your Cock Into My Pussy, Please. Nagisa Miyabi

  • amateur uncensored10musume
    • 2021-12-04
    40 min

    FC2PPV 2486331 First Shot! !! [New Cinema Style] Limited Number! [Uncensored] Pretty Beauty Big Tits Gcup Active Female College Student … Creampie Twice In A Beautiful Body That Is Panting And Disturbed! !! (3 Times Ejaculation Feature Film)

  • amateur uncensoredfc2
    • 2021-12-15
    45 min

    229SCUTE-1160 Akane (22) S-Cute Kiss To Aggressive Cleavage Beauty And Sex (Akane Shiki)

  • amateur censoredbig titsamateurscutescute-1160scute1160229scute-1160
    • 2021-12-18
    115 min

    [NCYF-014]Crazy 8-person Orgy! Short Height 140m 18 Year Old Beautiful Girl In Elf Cosplay. Barely Legal With A Pure White Body For Intense Amateur Photo Group Session "That"s Enough, I"m Cumming!" (Bent Over To Get Fucked For A Craze

  • censoredcreampiecosplayNCYFall japan amateur photographers union daydream fantasy loversudagawaNCYF-014NCYF014ncyf00014
    • 2021-12-31
    189 min

    [MIAA-554]Ban Lifted. The Throat Takes A Hit. Deep Throat. A Roaring Piston Going Through A Slender Neck. Miyuki Arisaka

  • arisaka miyuki censoredbig titsdeepthroatMIAAmoodyzkogoro kindaichieveryone s porn starMIAA-554MIAA554miaa00554
    • 2022-01-08
    40 min

    C0930 ki220108 Sanae Arai 52years old

  • amateur uncensoredc0930
    • 2022-01-13
    48 min

    520SSK-046 Yui

  • amateur censoredcreampieamateursskssk-046ssk046520ssk-046
    • 2022-01-14
    123 min

    [TPPN-216]Umi Natsukawa With Her Beautiful Sweaty Tits: Storm Of Climax Getting Piston Fucked By Coks On A Trip - Climax Sex, Wet With Bodily Fluids Getting Repeatedly Fucked

  • umi natsukawa censoredcreampiebig titsTPPNteppanTPPN-216TPPN216tppn00216



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download