t28




FC2SANONEZVENUNGODVENXAUKGCESDROYDHDKANATRPPPDCAWDSSISSQTEAWDAUKGBBANBLKIPXMILK

2020-12-24
483 min

[SHIC-198]Adolescence.com Adolescent Fiction 8 Hours The Best

  • censoredcreampiebig titsSHICadolscence.comSHIC-198SHIC198h-839shic00198
    • 2020-12-25
    128 min

    [ECB-143]Loving 2 Shots - Sara Ryuboku

  • uryuki sara censoredblowjobbeautiful girlECBwaap entertainmentkurumi ichinosecobra warpECB-143ECB1432ecb00143
    • 2021-01-05
    62 min

    SIRO-4382 [First shot] [I love the back of the vagina] [Traceful luster blowjob] Professional student who is curious about naughty things. If you feel like you’re sick of stimuli other than masturbation after a long time and keep knocking on the

  • amateur censoredamateursirosiro-4382siro4382siro-4382
    • 2021-01-08
    128 min

    [DIC-081]The Miracle Of Hyogo! Beauty Parlor Babe With Limitless Lust Ran Kusunoki Makes Her Porn Debut - Edged To The Limit Of Her Senses - Her First Multiple Orgasms!

  • kusunoki orchid censoredsquirtingblowjobDICprestigetsuruhashidiscoverDIC-081DIC081118dic00081
    • 2021-01-09
    181 min

    [MIDE-871]Huhhh？ Your Nipples Are Really Sensual My Cousin Treats Me Like A C***d And Kept On Tweaking My Nipples And Made Me Cum Like An Idiot For 3 Straight Days... Nozomi Ishihara

  • ishihara hope censoredcreampiebig titsMIDEmoodyzgoemonmoodyz divaMIDE-871MIDE871mide00871
    • 2021-01-22
    103 min

    [HZGD-176]Creampie Cheat Tour With A Beloved Mistress - Nene Tanaka

  • nene tanaka censoredcreampiebig titsHZGDmarried woman flower garden theaterzampaimage married woman flower garden theatHZGD-176HZGD176h-1100hzgd00176
    • 2021-01-23
    78 min

    [IKST-011]Who's This Amateur？ Shocking At-Home Sex With A Married Slut With Colossal Tits (Age 27) She's Got A K*d, Too

  • censoredcreampiebig titsIKSTsuddenly eroticIKST-011IKST011h-1454ikst00011
    • 2021-02-12
    123 min

    [SUPA-570]学校サボって今ホテル KAORI

  • censoredschoolgirlamateurSUPAs kyuu shiroutokaoruSUPA-570SUPA570h-244supa00570
    • 2021-02-12
    119 min

    [JUFE-257]Dense Licking Sexual Intercourse, Dripping Juices While Staring At A Man - Karen Usui

  • usui ren censoredsquirtingblowjobJUFEfitchJUFE-257JUFE257jufe00257
    • 2021-02-21
    150 min

    [JUL-481]Bridal Massage Parlor NTR - A Slender Wife Who Falls To A Therapist's Indecent Fingertips - Nozomi Higashi

  • nozomi higashi censoredcreampiemature womanJULmadonnaorion chairJUL-481JUL481jul00481
    • 2021-02-26
    270 min

    [DNW-111]Dear Beautiful Clerk. 02

  • censoredcreampiebig titsDNWprestigedocumentDNW-111DNW111118dnw00111
    • 2021-03-01
    300 min

    [DKSB-108]Do Chicks Love Dicks？! Picking Up Girls - We Showed 30 Hot Babes A Full Erection To See If They'd Get Horny, And Oh Boy Did They Ever! You Won't Believe What They Wanted To Do. 5-Hour Special

  • censoredamateurblowjobDKSBoffice k sks bestDKSB-108DKSB10836dksb00108
    • 2021-03-01
    120 min

    [HDKA-228]The Naked Maid Nude Maid Service Reina Aoi

  • aoi reina censoredcreampiebig titsHDKAplanet plusdirector orafu shukoHDKA-228HDKA228h-237hdka00228
    • 2021-03-04
    118 min

    [GS-2010]Sexual Massage Salon Voyeur 06

  • censoredGSgosGS-2010GS2010
    • 2021-03-11
    199 min

    [PIYO-107]"Stubborn Women Can't Resist Having Their Asses Fucked!" Rude Y********l Cries Out In Pleasure As I Fuck Her Up The Ass

  • censoredanalschoolgirlPIYOhyokopiero dagrey wolfPIYO-107PIYO1071piyo00107
    • 2021-03-12
    172 min

    [UMSO-378]She Went Out On A Call, And To Her Surprise, It Was To The Home Of An Acquaintance!？ She Made Him Promise To Only Pussy Grind, But He Slipped Her Some Aphrodisiacs, And She Started Feeling So Good She Let Him Stick It In Raw!! 4

  • inaba hikaru ikuno censoredbig titsUMSOk m produceumanamiUMSO-378UMSO37884umso00378
    • 2021-03-21
    141 min

    [DASD-835]The Story Of A Woman Who Wanted To Get Pregnant With Her Beloved Husband But Ended Up Being Impregnated By The Fertility Specialist! Yu Shinoda

  • shinoda yu censoredcreampiesingle workDASDdasrokusaburo mishimaDASD-835DASD835dasd00835
    • 2021-03-24
    116 min

    240TOKYO-422 Mitsuha

  • amateur censoredamateurbeautiful girltokyotokyo-422tokyo422240tokyo-422
    • 2021-03-26
    244 min

    [NASH-475]Real Sexy Stories 20

  • nozomi tanihara yu miyajima censoredmature womanNASHnadeshikoNASH-475NASH475h-067nash00475
    • 2021-03-27
    142 min

    [JUKF-059](Looking For Her Savior) Runaway Girl Naive And Innocent Y********l Who Doesn't Have Anywhere To Go Gets Trained And Broken In By A Man Who Love Barely Legals Erina-chan Erina Oka

  • hill erina censoredcreampiebeautiful girlJUKFjumpjump avJUKF-059JUKF059h-227jukf00059
    • 2021-04-09
    160 min

    [MDBK-171]Creampie With Excuses - High S*********l 4

  • ichika matsumoto tsukino sakura censoredcreampieschoolgirlMDBKbazookamaso knifeMDBK-171MDBK171mdbk00171
    • 2021-04-09
    120 min

    [MUDR-144]I Still Won't Give In... Beautiful Girl Continues To Resist Until She's G*******ged. Breaking In A Proud Babe With S&M And Confinement - Mitsuki Nagisa

  • scooping censoredcreampiebdsmMUDRmukuMUDR-144MUDR144mudr00144
    • 2021-04-10
    141 min

    [USAG-027]K-Cup/Colossal Tits/3 Fucks/Creampie/Self-Shot "Seeing Yourself Be This Sexy Will Give You Confidence" She's Normally Shy, But Not In The Bedroom! Girl Gets Bred With Thick, Creamy Cum!

  • censoredcreampiebig titsUSAGrabbit daydreamersUSAG-027USAG027usag00027
    • 2021-04-15
    92 min

    [VENX-029]What I've Wanted To Do Since I Became A Father-In-Law - My Son's Bride Loves Porn - Karen Otoha

  • karen otoha censoredcreampiemature womanVENXvenuskaniefakecest winntersVENX-029VENX029venx00029
    • 2021-04-20
    45 min

    498DDH-008 [Men’s Esthetic Voyeur] The older sister in charge happily massages my inguinal region, saying, "Because it’s a treatment …" After that, a ridiculous treatment! !!

  • amateur censoredcreampiebig titsddhddh-008ddh008498ddh-008
    • 2021-05-07
    270 min

    [DNW-092]【期間限定販売】パパ活成敗っ！ 【ナマイキ娘をタダまんダマし喰い】 01

  • amateur censoredcreampiebig titsdnwdnw-092dnw092dnw-092
    • 2021-05-07
    60 min

    230OREC-754 Rin

  • amateur censoredcreampieamateurorecorec-754orec754230orec-754
    • 2021-05-11
    64 min

    Caribbeancom 051121-001 Sex practice with my sister-in-law who wants to work in luxury spa Rino Sakuragi

  • rino sakuragi uncensoredcreampiecaribbeancom
    • 2021-05-21
    92 min

    300NTK-573 Beautiful F Cup Calligrapher’s Calligrapher’s Calligrapher * Nuki! !! This is Yamato Nadeshiko, a big-breasted black-haired maiden who teaches hot-blooded rawness with a hand-picking chin-taking handwriting! !! The gap to blame w

  • fsex censoredcreampiebig titsntkntk-573ntk573300ntk-573
    • 2021-05-22
    120 min

    [HOMA-105]I Shared A Room With My Two Female Bosses On Business Trip And They Made Me Piledrive Fuck Them Hard And Fill Them Up With Cum Over And Over Again Until Morning. Reiko Kobayakawa , Yuki Jin

  • kobayakawa reiko yuki god censoredcreampieslutHOMAh m p doramajo asagiriHOMA-105HOMA105homa00105
    • 2021-05-22
    240 min

    [MKMP-399]SUPER COMPLETE BEST Yu Shinoda

  • shinoda yu censoredcreampiebig titsMKMPkm producetaro kmillionMKMP-399MKMP399mkmp00399
    • 2021-06-04
    163 min

    [HODV-21578]Former Celebrity Debut - Oto Haruno

  • haruno oto censoredbig titssingle workHODVh m phimu lockHODV-21578HODV215785642hodv21578
    • 2021-06-11
    126 min

    [BANK-042]A Coed Gal Hot Spring Resort Good Time A Super Beautiful Gal! These Aren't Fake Titties, These Are The Real Thing, Shaped Like Bowls, And Attached To A Genuinely Slutty And Horny Gal Chisato Morisaki

  • tomomi morisaki censoredanalcreampieBANKpussy banktake chanBANK-042BANK042h-1495bank00042
    • 2021-06-22
    137 min

    [KMHRS-044]Her Face and Body are Perfect？ An Unexpectedly Serious and Somewhat Masochistic and Perfectly Irresistable Gal's AV Debut Rima Arai

  • lima arai censoredbig titsamateurKMHRSsod creater40i fell in love with youKMHRS-044KMHRS0441kmhrs00044
    • 2021-06-25
    121 min

    [MIAA-461]Even Though I'm A Teacher I Couldn't Resist My S*****t's Seduction And I Fucked Her Raw Over And Over At A Love Hotel After School... Ena Koume Hana Himesaki

  • ena koume himesaki hana censoredcreampiebig titsMIAAmoodyzsapporo taroeveryone s porn starMIAA-461MIAA461miaa00461
    • 2021-06-27
    239 min

    [RDVHJ-134]Picking Up Amateur Housewives! Gallons Of Squirting! Gallons Of Creampie Jizz! 12 Loads! 4 Hours!

  • censoredbig titsmarried womanRDVHJgraffiti japanfair estRDVHJ-134RDVHJ13448rdvhj00134
    • 2021-06-30
    68 min

    FC2PPV 1896857 Until 7/7 2980 [Sanctions] A simple fair-skinned slender beautiful girl. She forcibly commits a frightened woman in large numbers and makes vaginal cum shot for 10 consecutive times.

  • amateur uncensoredfc2
    • 2021-07-01
    58 min

    324SRTD-0237 OK sign if your drinking friend is drunk! I got angry when I made a vaginal cum shot w

  • amateur censoredcreampieamateursrtdsrtd-0237srtd0237324srtd-0237
    • 2021-07-14
    196 min

    [HUNTB-055]No One Knows! My Coworker Loves To Kiss When She Gets Tipsy - And To Suck Cock, Too! And At Our Farewell Party For Her, She Went Wildest Of All...

  • censoredblowjobHUNTBhunterkoichi davidsonhhh groupHUNTB-055HUNTB055huntb00055
    • 2021-07-15
    75 min

    [erk-006]沢花(22)

  • amateur censoredbig titsamateurerkerk-006erk006erk-006
    • 2021-07-17
    126 min

    [MISM-206]Perfect Masochist 20-year-old Girl Loves To Get Fucked So Crazy Hard That She Cums Out Of Control! Yuri Omori.

  • yuri omori censoredcreampiebig titsMISMm girls labshura jinMISM-206MISM206mism00206
    • 2021-07-18
    180 min

    [EYS-067]Hidden SEX Shooting With One Of My Mom's Friends Who Likes To Take Care Of Me vol. 4

  • censoredbig titsblowjobEYSstudio i sEYS-067EYS067eys00067
    • 2021-07-27
    65 min

    FC2PPV 1943390 (No) Yariman Share House ① All Living With The Transcendentally Cute Nagisa Is Pulled Out

  • amateur uncensoredfc2
    • 2021-08-13
    151 min

    [MVSD-475]Threatening Nurse Call. Made To Come Several Times By The Dirty Big Dick In The Shared Hospital Room. The Devoted Housewife Nurse Who Was Creampied While She Can"t Speak. Hikari Kisaki

  • hikari hime censoredcreampiebig titsMVSDm s video groupnikusonms video groupMVSD-475MVSD475mvsd00475
    • 2021-08-20
    180 min

    [OFKU-188]The Stepmother Who Had A Fight With Her Husband And Came Over To Stay At Her Stepson"s Apartment... 180 Minutes

  • censoredcreampieOFKUstar paradiseofukuro tetsudouOFKU-188OFKU188h-254ofku00188
    • 2021-09-02
    32 min

    FC2PPV 2129074 [New Work, Half Price! ] ♀ 324 Female College Student Ri ◯ -Chan 20 Years Old 1st Time A Tall Slender Beauty Makes Her Av Debut With A Genuine Vaginal Cum Shot Prepared For Pregnancy With A Complete Appearance That Is Open To The World

  • amateur uncensoredfc2
    • 2021-09-09
    124 min

    [FSDSS-283]Luxury Soap. Attentive Dirty Talk And Treating Me With Cowgirl. Moe Tenshi

  • angel moe censoredFSDSSfalenokitchomfaleno starFSDSS-283FSDSS2831fsdss00283
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download