style




FC2BBANMILKHMNCHRVAWDFSDSSCESDSSNIMIAASQTEHDKAVENXIPXNACXNACRCAWDJULNATRAUKSSTARS

2019-07-21
117 min

[NSPS-820]I Made My Wife Model Lingerie. When Touched By Another Man, My Wife Easily... Reika Hashimoto

  • reika hashimoto censoredmarried womanmature womanNSPSnagae styletaro fujoNSPS-820NSPS820nsps00820
    • 2019-07-21
    404 min

    [NSPS-823]Specially Selected Actress Lives Only To Fulfill Her Sexual Desires - Best Of Tsubaki Kato

  • kato camellia kaoru natsuki censoredmarried womanmature womanNSPSnagae stylesano b sakutomi taketaroNSPS-823NSPS823nsps00823
    • 2019-07-20
    118 min

    [CJOD-199]For Five Days I Was Forced To Wear A Chastity Belt And Prevented From Having Infidelity Sex, And When I Was Finally About To Go Crazy, I Started Giving Blowjob Action, Over And Over And Over Again Nozomi Arimura

  • arimura nozomi censoredblowjobslutCJODchijo heavencontour styleCJOD-199CJOD199cjod00199
    • 2019-07-20
    61 min

    [HEYZO-2039]Ami Dominating A Mixed Japanese Girl -Playing Anal Sex Too-

  • ami uncensoredcreampieblowjobheyzo
    • 2019-07-17
    65 min

    [HEYZO-2037]Maki Houjyo Facial Cum Fiesta! Vol.3

  • maki houjyo uncensoredcreampieblowjobheyzo
    • 2019-07-15
    63 min

    [HEYZO-2036]Nanaha Tomori Sex Heaven -Tasting Her Hot Plump Body-

  • nanaha tomori uncensoredcreampiehandjobheyzo
    • 2019-07-14
    59 min

    [HEYZO-2035]Masako Sawamura Sex With A Shaved Amateur Girl

  • amateur uncensoredcreampieheyzo
    • 2019-07-13
    147 min

    [SSNI-524]Breaking In A Female Student In Uniform. Continuously Fucked By Middle-Aged Fanatics... Mako Iga

  • iga mako censoredschoolgirlsingle workSSNIs1 no 1 styleamazing meatSSNI-524SSNI524ssni00524
    • 2019-07-13
    147 min

    [SSNI-517]"I Came So Much I Have No Idea What's Going On..." Her Pussy Was Twitching And Trembling After Cumming, But Then She Got A Second Helping Of Relentless And Furious Piston-Pounding Sex Nami Hoshino

  • nami hoshino censoredslutsingle workSSNIs1 no 1 styledragon nishikawaSSNI-517SSNI517ssni00517
    • 2019-07-13
    60 min

    FC2PPV 1123847 Limited to 30! [Personal shooting] Model-class style 19-year-old JD is exhausted ♥ Begging for a cock while cramping with a vibe attached to a slender pussy! With the first seeding in my life, my 172 cm body collapses and smiles! [Sale

  • amateur uncensoredfc2
    • 2019-07-13
    120 min

    [SSNI-518]While My Boss Was Away On A Business Trip, I Fucked The Shit Out Of The Boss's Wife For 3 Whole Days. Tsukasa Aoi

  • tsukasa aoi censoredslutsingle workSSNIs1 no 1 stylekitorune kawaguchiSSNI-518SSNI518ssni00518
    • 2019-07-13
    68 min

    FC2PPV 1123352 [Bikini fucking pinch] Beach style bikini big breasts are rubbed and fucking 3 shots !! Amateur individual shooting 036

  • amateur uncensoredfc2
    • 2019-07-13
    118 min

    [SSNI-519]She'll Lure you To A Deep And Exquisite Pleasure That You've Never Ever Tasted Before The High-Class Luxury Lingerie Salon, Where You'll Experience A Lust More Erotic Than Nakedness Could Ever Be Aika Yumeno

  • yumeno aika censoredbig titslingerieSSNIs1 no 1 stylezaku araiSSNI-519SSNI519ssni00519
    • 2019-07-13
    149 min

    [SSNI-527]A Barely Legal Girl With A Godly Ass. Her First Big Orgasm. She Trembles! 3 Sex Scenes With Her Big Ass Trembling In Pleasure. Mahoro Kamiki

  • mahoro kamiki censoredsquirtingbeautiful girlSSNIs1 no 1 stylemon cSSNI-527SSNI527ssni00527
    • 2019-07-13
    62 min

    [HEYZO-2034]Mai Kamio After 6 -Fuck Me More! Please!-

  • mai kamio uncensoredcreampieblowjobheyzo
    • 2019-07-13
    213 min

    [SSNI-516]While My Girlfriend Was Away On Vacation, I Was Fucking Her Childhood Friend From Morning Until Night A 48-Hour Video Record Of My Infidelity Yua Mikami

  • yua mikami censoredbig titssingle workSSNIs1 no 1 stylebungo maedaSSNI-516SSNI516ssni00516
    • 2019-07-13
    175 min

    [SSNI-525]Enjoy These Amazing Titties 104cm J-Cup Titties Are Wiggling And Jiggling And Ready For You To Fondle And Lick Them To Your Heart's Content A 3-Hour Full Course Jun Kakei

  • jun jun censoredbig titsbeautiful girlSSNIs1 no 1 styletake dSSNI-525SSNI525ssni00525
    • 2019-07-13
    119 min

    [SSNI-521]Nympho Teacher Sleeps With Parents & Guardians In Miniskirt Temptation

  • nine yoshitaka censoredslutsingle workSSNIs1 no 1 stylekyoseiSSNI-521SSNI521ssni00521
    • 2019-07-13
    87 min

    390JAC-003 Endangered species “Overwhelming Black Gal” Capture Wu! !! GOD style of G cup huge breasts! !! The climax RUSH next to the climax from the tide Bishabisha! Of course, vaginal cum shot from ♪♪ 2 consecutive pursuits ~~ [Gal Shibe

  • amateur censoredbig titsamateurjacjac-003jac003390jac-003
    • 2019-07-13
    156 min

    [SSNI-520]Total Domain. She'll Constantly Tempt You With Her Beautiful, Slim Thighs. The Bewitching Beauty In Knee-High Socks. Arina Hashimoto

  • there is hashimoto censoredschoolgirlsingle workSSNIs1 no 1 stylemichiru arashiyamaSSNI-520SSNI520ssni00520
    • 2019-07-13
    149 min

    [SSNI-528]Fresh Face NO.1 STYLE The Celebrity Marin Hinata Her Adult Video Debut

  • marin hinata censoredbig titssingle workSSNIs1 no 1 stylemon cSSNI-528SSNI528ssni00528
    • 2019-07-13
    118 min

    [SSNI-522]I'm So Attracted To The Man I Hate The Most... Yura Kano

  • yura kanno censoredbeautiful girldramaSSNIs one number one styleasagiris1 no 1 styleSSNI-522SSNI522ssni00522
    • 2019-07-13
    154 min

    [SSNI-523]My Girlfriend's Big Sister Seduced Me With Her Beautiful Legs And Panty Shots And I Couldn't Resist The Temptation. Ichika Hoshimiya

  • ichika hoshimiya censoredblowjobhandjobSSNIs one number one stylegoemons1 no 1 styleSSNI-523SSNI523ssni00523
    • 2019-07-13
    479 min

    [OFJE-206]Miharu Usa The 3rd Anniversary Of Her S1 Debut Commemorative Best Hits All New 10 Titles, 48 Episodes 480-Minute Special

  • miharu hanasaki censoredbig titsbeautiful girlOFJEs one number one styles1 no 1 styleOFJE-206OFJE206ofje00206
    • 2019-07-11
    160 min

    [MIST-266]Reiko Kobayakawa Will Service You Cowgirl Style At This Bubbly Body-Washing Massage Parlor

  • kobayakawa reiko censoredcreampiesingle workMISTmr michiruc tMIST-266MIST2661mist00266
    • 2019-07-11
    64 min

    [HEYZO-2032]Kumiko Kikuchi A Wife In A Rough Patch Cheats On Husband

  • kumiko kikuchi uncensoredcreampieheyzo
    • 2019-07-10
    59 min

    FC2PPV 1121607 [Personal shooting] Model-class style 19-year-old JD is exhausted ♥ Begging for a cock while cramping with a vibe attached to a slender pussy! With the first seeding in my life, my 172 cm body collapses and smiles! [Sales approved]

  • amateur uncensoredfc2
    • 2019-07-09
    50 min

    [HEYZO-2031]Chika Sugiyama Raw Sex With A Beautiful Woman -Huge Load Creampie-

  • chika sugiyama uncensoredcreampieblowjobheyzo
    • 2019-07-08
    123 min

    [NSPS-816]Three Days Without My Wife: I Passionately Fucked My Sister-in-Law When She Came To Take Care Of The Kids. Tsubasa Haneda

  • haneda tsubasa censoredmature womansingle workNSPSnagae stylenagaeNSPS-816NSPS816nsps00816
    • 2019-07-08
    355 min

    [NSPS-817]Real Video Sexual Violation Eroticism 4

  • censoredmature womandramaNSPSnagae stylejotaro tomiNSPS-817NSPS817nsps00817
    • 2019-07-08
    273 min

    [NSPS-818]The Best Of Serious But Sexually Frustrated Married Women ~My Husband Was The Only Person I Ever Slept With~

  • natsuko mishima nozomi tanihara censoredmature womandramaNSPSnagae stylejotaro tomiNSPS-818NSPS818nsps00818
    • 2019-07-08
    67 min

    FC2PPV 1121070 ☆ First shot ☆ Complete appearance ☆ Model-like style ♥ Slender little erotic I fired a dark sister to my older sister! [With benefits]

  • amateur uncensoredfc2
    • 2019-07-07
    63 min

    [HEYZO-2030]Kotono Kanamori POV Video of Amateur Slutty Babe Vol.3

  • amateur uncensoredcreampieheyzo
    • 2019-07-07
    148 min

    [MIAA-114]"Hey... I Know You're Listening To My Naughty Voice" The Horny Neighbor Who's Always Masturbating Started Talking To Me Through The Wall. Yu Shinoda

  • shinoda yu censoredsquirtingslutMIAAmoodyzcontour styleeveryone s porn starMIAA-114MIAA114miaa00114
    • 2019-07-07
    185 min

    [MIRD-189]Private Huge Ass Sports School Banging Cowgirl Creampie Club

  • emi okuna miku abe censoredcreampieMIRDmoodyzcontour stylemoodyz realMIRD-189MIRD189mird00189
    • 2019-07-07
    96 min

    300MIUM-458 [Slender F Breasts] Rent a god-style active JD as her! Completely REC the whole story that was spoiled up to the originally prohibited erotic acts by persuading! Take it to a hotel with a view of the sea and devour a perfect body! !! Geki

  • amateur censoredbig titsamateurmiummium-458mium458300mium-458
    • 2019-07-06
    60 min

    [HEYZO-2029]Rei Furuse Facial Cum Fiesta! Vol.2

  • rei furuse uncensoredcreampieblowjobheyzo
    • 2019-07-05
    140 min

    [UMD-694]Doggie Style Only - Ass Fucking - Best Selection TOP 20 Ver. 2019

  • yano tsubasa mitani akari censoredcreampieUMDleotabu osakiUMD-694UMD694125umd00694
    • 2019-07-04
    151 min

    [SSNI-511]Thin Curvy Teen And Filthy Stretch Shop, Rikka Inui

  • dry censoredsquirtingsingle workSSNIs1 no 1 stylerakudaSSNI-511SSNI511ssni00511
    • 2019-07-04
    68 min

    [HEYZO-2027]Eri Hara Amateur Married MILF Got Tied Up

  • eri hara uncensoredcreampieblowjobheyzo
    • 2019-07-04
    119 min

    [SSNI-507]Swimming Married Woman Fuck Marathon Pool Pervert, Saki Okuda

  • saki okuda censoredbig titssingle workSSNIs1 no 1 styleamazing meatSSNI-507SSNI507ssni00507
    • 2019-07-04
    154 min

    [PRED-166]Male Squirting Expert Loves Seeing Their Partner In Ecstasy! Climax Hunter Amateur Student Porn Performance!

  • censoredsquirtingamateurPREDpremiumcontour styleelegancePRED-166PRED166pred00166
    • 2019-07-04
    147 min

    [SSNI-510]Colossal Tits Schoolgirl in Uniform Completely Tied Up And Forcibly Violated, Shion Yumi

  • evening beauty censoredbig titsschoolgirlSSNIs1 no 1 styleamazing meatSSNI-510SSNI510ssni00510
    • 2019-07-04
    118 min

    [SSNI-515]Fresh Face No. 1 Style Mao Mashiro Porn Debut

  • pure white censoredbig titssquirtingSSNIs1 no 1 stylezaku araiSSNI-515SSNI515ssni00515
    • 2019-07-04
    152 min

    [JUY-900]"Divine Tits" I Cup Popular Series Appearance!! Married Woman Across The Hall, Nanami Matsumoto

  • nana matsumoto censoredbig titsmature womanJUYmadonnajo styleJUY-900JUY900juy00900
    • 2019-07-04
    164 min

    [SSNI-512]Defenseless Big Tits Beautiful Girl Who Moved In Next Door And Shut-in Otaku's (Me) Lust. Hotaru Nogi

  • nogi firefly censoredbig titscosplaySSNIs one number one stylebungo maedas1 no 1 styleSSNI-512SSNI512ssni00512
    • 2019-07-04
    168 min

    [SSNI-509]Shameless Fuck After Abstinence, Miru Sakamichi

  • see the slope censoredsquirtingbeautiful girlSSNIs1 no 1 stylexavier thomasSSNI-509SSNI509ssni00509
    • 2019-07-04
    119 min

    [SSNI-513]Unimaginable Climax Squirting! Small Teen's G-Spot Loves Big Cock, Rika Aimi

  • rumi tadami censoredbig titssquirtingSSNIs1 no 1 stylezaku araiSSNI-513SSNI513ssni00513



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download