studio i s




FC2IPXMIDVMIDEDASDHZGDABWAVSAADNNACXHDKASHKDDTTMVSDWAAACHRVHNDMEYDSPRDRBDAPOD

2020-12-27
82 min

FC2PPV 1622672 [Personal shooting] [No] Happening! ？？ Hidden camera! ？？ A visitor during the shooting! !!

  • amateur uncensoredfc2
    • 2021-01-03
    83 min

    300NTK-495 Erotopia tall 172cm beauty GAL! !! Hard SEX lovers who are good at reverse Nan with Echiechi underwear! ？？ SEX party starts with erotic girls who are lifted up with norinori tension! !! Directly thrust the finest beauty with shining underw

  • cmgal censoredcreampieamateurntkntk-495ntk495300ntk-495
    • 2021-01-24
    125 min

    [CESD-972]Tearful Non-Stop Orgasmic Sex 4 - Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampiemature womanCESDceleb no tomoCESD-972CESD972cesd00972
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-26
    28 min

    359TYVM-134 Mizuho

  • amateur censoredbig titsamateurtyvmtyvm-134tyvm134tyvm-134
    • 2021-02-26
    39 min

    FC2PPV 1702827 First shot [Uncensored / Individual shot] Super serious JD plays uniform with his first daddy activity! Forced vaginal cum shot! * Immediate deletion of body

  • amateur uncensoredfc2
    • 2021-02-27
    120 min

    [MIRD-210]My Colleagues From My Part-Time Job Missed Their Last Train Home, So Now They're Spending The Night At My Place!! They're Unleashing Their Full Erotic Powers And Wiggling And Jiggling Those 4 Big Divine Titties Until The Break Of Da

  • tsubaki rika nene tanaka censoredbig titsslutMIRDmoodyzwild sevenmoodyz realMIRD-210MIRD210mird00210
    • 2021-03-02
    57 min

    FC2PPV 1708499 [Personal shooting] ♀201 Female college student Mi ◯ -chan 20 years old, ♀ 269 Gravure Mari ◯ -chan 20 years old 1st (3P) New Year’s Ox Year Orgy Festival! You can remodel it into a Holstein that produces milk by seeding it! (Expl

  • amateur uncensoredfc2
    • 2021-03-03
    120 min

    [PFES-009]My Very Own Lingerie Model Starting One Night The Hottest Girl In My Company Couldn't Result My Seduction And I've Been Fucking Her Raw Since Yu Shinoda

  • shinoda yu censoredcreampiebig titsPFESpremiumtrendy yamaguchisummer panties festivalPFES-009PFES009pfes00009
    • 2021-03-04
    62 min

    [KBTV-068]A Married Woman Shows A Side Of Herself That Her Husband Never Gets To See Misako-san

  • censoredcreampiebig titsKBTVfirst av appearanceKBTV-068KBTV068h-244kbtv00068
    • 2021-03-11
    48 min

    FC2PPV 1721751 [No] Big breasts poverty graduate student who was in trouble with school expenses 1 Is it okay to have a vaginal cum shot with Sakichi？ ♥ ️ Limited number discount only now ※ Review privilege / Denma strong and bicubic masturbation ♥

  • amateur uncensoredfc2
    • 2021-03-20
    35 min

    FC2PPV 1734437 [Smooth skin, light cherry-colored nipples] [Face bald benefits available] A beautiful female student I met in Kyoto, Asama ◯ Gonzo! The super beautiful minimum nipple was exposed and the super smooth skin was dyed with a cloudy liquid

  • amateur uncensoredfc2
    • 2021-03-30
    52 min

    492JCHA-046 Feeling tons？ Feeling tons？ Doya erotic Masaya

  • amateur censoreduniformschoolgirljchajcha-046jcha046492jcha-046
    • 2021-04-05
    66 min

    SIRO-4473 [First shot] [Swaying married woman’s soft milk] [Wife is dirty] Frustrated wife who has been married for 10 years is crazy about sex with other than her husband. She disturbs her big tits and greets her climax, she rides on a man .. A

  • amateur censoredbig titsmarried womansirosiro-4473siro4473siro-4473
    • 2021-04-26
    63 min

    SIRO-4503 [First shot] [Slender standing back] [Make your abs jerk ..] Active JD with an innocent smile. She does not look good on her face and fascinates her daring way of dying, she panting with her standing back that fascinated her long legs .. AV

  • amateur censoredsquirtingamateursirosiro-4503siro4503siro-4503
    • 2021-05-10
    68 min

    10musume 051021_01 I’ll cure your impotence Rio Yano

  • amateur uncensored10musume
    • 2021-05-21
    178 min

    [URE-066]Original Work: Fetakishi The Slutty Wives Of The Shopping District We've Loyally Recreated The Impregnating Sex That Transforms Docile Big Titty Wives Into Pliant Sex Animals! Asahi Mizuno

  • mizuno chaoyang censoredbig titsmature womanUREmadonnakitorune kawaguchiure.comiURE-066URE066ure00066
    • 2021-05-29
    53 min

    300NTK-578 [Extreme Black Butt x Extreme Constriction x Natural Black GAL + Bringing Aphrodisiac = Pleasure Hell] Beautiful Slender Beautiful Body Gal Kimeseku! !! Everything is too disgusting and Oma ○ Kodam broke down! !! Bed soaked big sexual inte

  • amateur censoredcreampieamateurntkntk-578ntk578300ntk-578
    • 2021-07-01
    37 min

    FC2PPV 1898023 [No] [Appearance] [Review benefits] Gonzo the president’s secretary REN for the first time in a year ♡ Vacuum blowjob and seeding press!

  • amateur uncensoredfc2
    • 2021-07-02
    184 min

    [NKKD-213]Taking A Married Woman Into The Public Bathrooms While She's On A Drive With Her Family And Fucking Her! 7 Toilet Sex

  • censoredNKKDjet eizomanji groupNKKD-213NKKD213nkkd00213
    • 2021-08-05
    70 min

    326MASS-005 Echiech Momojiri College Student / Ria-Chan (19) Reasonly Jumps And Climax Ascension With The Power Of Aphrodisiac And Sexual Feeling Oil Massage! !! I Am Stunned By The Waves Of Pleasure That Rush In Many Times! !! A Large Amount Of Vagi

  • amateur censoredcreampieamateurmassmass-005mass005326mass-005
    • 2021-08-16
    60 min

    10musume 081621_01 Amateur Av Interview: I Was Supposed To Do Bj Only, But Somehow I Started To Feel Really Good, And Wanted To Get Fucked Sae Sekine

  • amateur uncensored10musume
    • 2021-08-20
    117 min

    [HMN-026]Fresh Face: A Beautiful Girl Who Works For A Travel Company - She Wants To Have An Extraordinary Sexual Experience, So She Started Her AV Debut With A Creampie!! Emi Imai

  • emi imai censoredcreampiebeautiful girlHMNhonnakataiga kosakaiHMN-026HMN026hmn00026
    • 2021-08-21
    61 min

    1Pondo 082121_001 I Will Teach You How To Handle The Cock In Practice! Kurumi Kokoro

  • amateur uncensored1pondo
    • 2021-08-24
    63 min

    Pacopacomama 082421_522 Big Tits Wife In Estrus Yumiko Kinoshita

  • amateur uncensoredpacopacomama
    • 2021-09-17
    165 min

    [DVDMS-714]"My Dream Since I Was Young Was To Become An AV Actress" 19-Year-Old Fresh Face College Girl. Miiro Nanasaki Makes Her AV Debut. Perfectly Narrow Waist On A Beautiful Girl Who Has Worked Hard On Her Own To Be An AV Star With Tons O

  • nanasaki miiro censoredbeautiful girlsingle workDVDMSdeepsyo sukeDVDMS-714DVDMS714dvdms00714
    • 2021-09-29
    54 min

    FC2PPV 2268590 [Personal Shooting] ♀43 Professional Student Mi ◯ -Chan 18 Years Old 87th Time Dirty Sex Slave ◯ Was Given An Ovulation Inducer, And Instead Of The Beginning, She Was Naked And Irresponsibly Impregnated With Gachinko Seeding And Had Va

  • amateur uncensoredfc2
    • 2021-10-09
    150 min

    [MDBK-202]The Female Doctor Who Has Big Tits: Obscene and Unprotected Sex Counseling

  • arioka miu anri namiki censoredcreampiebig titsMDBKk m producebazookaMDBK-202MDBK202mdbk00202
    • 2021-10-09
    114 min

    [BABM-004]Sweet And Cute Waka Acts Like A Mommy To Give Me Smothering Praise And Baby Me While Offering Tons Of Sex. Waka Misono

  • misono waka censoredcreampiebig titsBABMkaguya hime pt mousozokuyumesaki ichiroubabubabu no jitsuBABM-004BABM004babm00004
    • 2021-10-16
    89 min

    300MAAN-707 [Must Fall In Love! !! Geki Kawa Nice Bottom Concafe Clerk] 100 Points Of Erotic Cuteness With A Sense Of Distance That Captivates A Man And Cute Gestures! !! Completely REC The Whole Story That Nozomi Who Likes To Blame With A Cute Face

  • amateur censoredamateurcosplaymaanmaan-707maan707300maan-707
    • 2021-10-16
    140 min

    [DDHH-032]Confinement, Peeing In Her Panties In The Classroom, Mio Mashiro

  • mio mashiro censoredschoolgirldeepthroatDDHHdogmahidekiDDHH-032DDHH032ddhh00032
    • 2021-11-14
    75 min

    533NNS-017 P Kansai Girls Who Are Lively! !! The Main Business Of An Active Wedding Planner, That’s The Pleasure Service! !! Rich Service! !! 2 Squeezing Mouth And Vaginal Cum Shot! !!

  • amateur censoredcreampieamateurnnsnns-017nns017533nns-017
    • 2021-11-17
    53 min

    444KING-056 Misaki

  • amateur censoredcreampiemarried womankingking-056king056444king-056
    • 2021-11-19
    240 min

    [SSIS-252]Saika Kawakita"s 10 Transformations - The Ultimate Masturbation Support

  • ayaka hebei censoredblowjobbeautiful girlSSISs one number one stylebungo maedas1 no 1 styleSSIS-252SSIS252ssis00252
    • 2021-11-25
    140 min

    [368ICHK-002]いちゃはこっ！純度100恥ずかしがり屋桜井千春

  • amateur censoredcreampieamateurichkichk-002ichk002368ichk-002
    • 2021-11-25
    92 min

    [OKB-124]Maika Hiizumi - Curvy Big Ass, Barely Legal Beautiful Girl In Gym Shorts, Chubby Girl Busting Out Of Her Gym Shorts, Putting On Gym Uniforms, Underwear Sticking Out, See Super Close-up Pussy Shots That Practically Show Every Little Pore! Ass

  • maika hizumi censoredsingle workbukkakeOKBoyaji no kosatsukami bloomersOKB-124OKB1241okb00124
    • 2021-11-25
    121 min

    [HBAD-602]妖艶な弟の嫁に禁断の中出し夜●い 凛音とうか

  • roaring sound censoredcreampiesingle workHBADhibinounicorn fukudababeHBAD-602HBAD6021hbad00602
    • 2021-12-05
    68 min

    300NTK-669 [High-Flying P Active Beauty] [Nature Is Simply Lewd] [Do Nasty Echiechi G Cup] Somehow I Don’t Like It. !! If You Hang A Carrot With Your Pocket Money And Peel Off The High-Flying Plating, You Will Simply Discover That It Is A Lasciv

  • amateur censoredcreampiebig titsntkntk-669ntk669300ntk-669
    • 2021-12-09
    174 min

    [DANDY-790]At A Mixed Bathing Hot Springs We Thought Was Secluded, A Beautiful Lewd Woman Who Enjoys Men And Women Gets Couples To Have Non-stop Adulterous Threesomes.

  • censoredlesbianDANDYdandybacon tanakaDANDY-790DANDY7901dandy00790
    • 2021-12-16
    125 min

    [AARM-043]Erotic Ass: Anal Showing Cowgirl 2

  • marina saito maki kyoko censoredanalslutAARMaroma planningmania satoshiaromaAARM-043AARM043aarm00043
    • 2021-12-24
    120 min

    [JUL-802]First Movie With Black Man As Madonna Exclusive! Married Woman Goes Weak For Black Cock! Story Of Cuckold Whose Wife Falls For Giant Cock Marina Shiraishi

  • rena shiraishi censoredcreampiebig titsJULmadonnamametaro mamezawaJUL-802JUL802jul00802
    • 2022-01-13
    113 min

    [GS-418]Married Woman Shame An Alluring Young Wife Who Works At A Cafe Is Bashfully Wearing A Miniskirt, Exposing Her Panties, But Instead Of Being Embarrassed, She"s Lustily Showing Off Her Goods! It Appears That She Had Become Dripping Wet, And

  • censoredGSsosoru x garcontumblerGS-418GS4181gs00418
    • 2022-01-15
    124 min

    [EVIS-390]Handjob While Looking At Sweaty Feet That Have Been Stewing In Pantyhose For 48 Hours

  • sakikazu sasaki pure white censoredsluthandjobEVISebisusan mousou zokucherry miyamaEVIS-390EVIS390evis00390
    • 2022-01-21
    57 min

    [230OREC-998]新井アナ

  • amateur censoredcreampiebig titsorecorec-998orec998230orec-998
    • 2022-01-22
    57 min

    Pacopacomama 012122_597 First Document By Amateur Wife, 97: Yukari Sato

  • amateur uncensoredpacopacomama
    • 2022-01-29
    117 min

    [EVIS-391]Showing Off Provocative Lesbian Kisses, Stained Panties, Handjob

  • anne mashiro minami saya censoredlesbianhandjobEVISebisusan mousou zokucherry miyamaEVIS-391EVIS391evis00391
    • 2022-02-20
    52 min

    230OREC-1022 Yuria-Chan (Yuria Hafuu)

  • amateur censoredamateurbeautiful girlorecorec-1022orec1022230orec-1022



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download