sqte




FC2NATRAUKGKBIVENUCAWDONEZJULAUKSVENXATIDABWSHKDMILKDTTMEYDHNDCHRVNACRGVHAWD

2020-11-22
228 min

[REXD-344]Sexual Relations From Voyeur Photographs Married Women Coerced Into Going Home! "Our Relationship...I'm Sure You Don't Want Your Husband To Find Out"

  • censoredcreampiebig titsREXDredmanji groupREXD-344REXD344rexd00344
    • 2020-11-30
    77 min

    IDJS-022 Natsuki

  • amateur censoredcreampiebig titsidjsidjs-022idjs022idjs-022
    • 2020-12-06
    109 min

    [VENU-983]Saw My Mother-In-Law's Thick, Mature, Naked Body The Other Day, And It Made Me Rock Hard Chisato Shoda

  • shota chisato censoredcreampiebig titsVENUvenussarufakecest winntersVENU-983VENU983venu00983
    • 2021-01-01
    132 min

    [GOJU-175]Amateur Housewife Porn Audition - Unsatisfied 50-something Beautiful Mature Woman Comes Looking For Dick

  • censoredcreampieamateurGOJUfifty somethingGOJU-175GOJU175h-1165goju00175
    • 2021-01-06
    56 min

    FC2PPV 1634401 Very beautiful woman] Former idol housewife, 25 years old, a wife who can’t get rid of her SEX habit playing in the entertainment world! Get out during a couple date and have sex with others! The whole story of a horny slut who is

  • amateur uncensoredfc2
    • 2021-01-09
    155 min

    [MIFD-145]A Fresh Face A Real-Life English Female Teacher From A Famous Private School She's Bilingual And Quarter-Japanese And Beautiful Her Adult Video Debut She's About To Quit Her Job And Move Overseas In A Month, But Suddenly Her Plans C

  • aso margaret nanami censoredsingle workMIFDmoodyzmichiru arashiyamamoodyz freshMIFD-145MIFD145mifd00145
    • 2021-01-15
    67 min

    FC2PPV 1645984 [Uncensored] Healing Menes Bishoujo Yui-chan’s black pantyhose tight mini dress and seeding press on the verge of brain !! Miss Menes: Yui-chan (19 years old) ③

  • amateur uncensoredfc2
    • 2021-01-16
    56 min

    H0930 ki210117 Yuri Arishima 35years old

  • amateur uncensoredh0930
    • 2021-01-23
    42 min

    [HHKL-081]All Alone With The Hottest Girl At Work During A Downpour... Her Blouse Is Soaked Right Through And I Can See Her Tits... Which Got Me Hard. When She Noticed, She Turned Red - Then Started Hitting On Me？! Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampieuniformHHKLhuntermorikihhh groupHHKL-081HHKL081hhkl00081
    • 2021-01-25
    234 min

    [MJBB-001]Girls From The Minato Ward: Arrogant Girls With Sopping Wet Pussies From The Minato Ward - POV Video

  • censoredbig titsamateurMJBBminato ward girlsMJBB-001MJBB001h-1554mjbb00001
    • 2021-01-30
    155 min

    [WAAA-032]She Came, Over And Over Again, When He Fucked Her With The Biggest Dick Of Her Life... Large Orgies With Black Cock Creampies *A Big Dick Power Fuck Fest* - An Abnormally Horny Wife Who Won't Be Satisfied With Her Husband's Tiny Dic

  • ayaka mochizuki censoredslutsingle workWAAAwanz factorywanzWAAA-032WAAA032waaa00032
    • 2021-02-06
    146 min

    [JUL-465]I, The Greeter, Went On An Adulterous Drive With The Company President's Wife. Maki Hojo

  • hojo asahi censoredmature womansingle workJULmadonnahiroyuki kimuraJUL-465JUL465jul00465
    • 2021-02-06
    240 min

    [DVDMS-626]Facials In The One-Way Mirror Cab - College Girls Only - The One-Way Mirror - College S*****t Amateur Real Guy-Girl Platonic Friends Challenged To Their First-Ever Thigh Sex! When The Two Of Them Are All Alone Together And Cock Rubs Clit,

  • censoredcreampieamateurDVDMSdeep sfunky hasegawathe magic mirrorDVDMS-626DVDMS626dvdms00626
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-17
    132 min

    496SKIV-004 Mana-chan who loves raw squirrel 2

  • amateur censoredcreampieamateurskivskiv-004skiv004496skiv-004
    • 2021-03-05
    138 min

    [SKSK-045]This Job-Seeking S*****t Has Soft And Plush J-Cup Colossal Tits Viva! Illicit Sexual Relations Nenne Ui

  • first love censoredcreampiebig titsSKSKprestigesukesukeSKSK-045SKSK045118sksk00045
    • 2021-03-06
    132 min

    [BBAN-314]Lesbian Gray: What Earns More？ Cash Or A Woman's Body...

  • satoshi kuruki misono waka censoredlesbianbeautiful girlBBANbibianBBAN-314BBAN314bban00314
    • 2021-03-15
    110 min

    300MIUM-694 [Creampie in H cup OL! ] A tall office lady with a lump of aesthetics and a trip to skip! If you peel off the skin of 120 throat big breasts, you’ll have too many dreams and you’ll be out of control! !! Roll up the hustle in the

  • amateur censoredcreampiebig titsmiummium-694mium694300mium-694
    • 2021-03-15
    67 min

    FC2PPV 1728042 [First time limited 1000pt off] Former J ● L flight attendant’s beautiful wife ❤️ Secret meeting with husband and children ❤️ Daytime SEX flight ❤️ Former CA ❤️ spree in the back of the vagina Excited and a large amount of semen i

  • amateur uncensoredfc2
    • 2021-03-18
    146 min

    [SSIS-018]Step Sibling Sexual Tension Explodes After 12 Years And They Spend Three Days Fucking Like Crazy Izuna Maki

  • izuna maki censoreduniformschoolgirlSSISs1 no 1 styletake dSSIS-018SSIS018ssis00018
    • 2021-03-20
    121 min

    390JAC-085 [G Big Breasts Golfer x Creampie Facials 4 Barrage] G Big Breasts Kitsukitsuma ● Hole in One! Unequaled libido super sensitive constitution Ikuiku chip in birdie! Bishabasha Squirting "This tide far!" This woman is exactly the priz

  • amateur censoredcreampiebig titsjacjac-085jac085390jac-085
    • 2021-03-21
    135 min

    [JUL-514]Our Adultery Started With A Fateful Encounter, The Kind You See In Those Romantic Dramas On Mondays At 9 But When She Found Out That I Was A Premature Ejaculator, She Made Me Creampie Cum Over And Over Again Like A Sad Loser. Honoka Kimura

  • honoka kimura censoredcreampiemature womanJULmadonnaunicorn fukudaJUL-514JUL514jul00514
    • 2021-03-26
    86 min

    510ELLO-003 Pachislot / Karaoke / Private house side Home rental gal god video

  • amateur censoredamateurbeautiful girlelloello-003ello003510ello-003
    • 2021-03-27
    130 min

    [RMER-001]Popsicle Man - Ai Hitomi

  • hitomi love censoredsingle workRMERrare daydream tribetamao arakiRMER-001RMER001rmer00001
    • 2021-03-28
    65 min

    511SDK-001 Gonzo With A Girl Who Is Too Cute And Love Hotel [Amateur Life Gonzo]

  • amateur censoredbig titsamateursdksdk-001sdk001511sdk-001
    • 2021-04-01
    20 min

    HEYZO 2492 Erotic Massage for Azusa – Azusa Onuki

  • azusa onuki uncensoredblowjobcumshotheyzo
    • 2021-04-23
    147 min

    [MIDE-916]What？ Now？ Here!？ Unstoppable Follow-Up Piston-Pounding Sex, And You Must Not Get Caught, And You Must Not Make A Sound Hana Kotone

  • kotoneka censoredsquirtingbeautiful girlMIDEmoodyzmichiru arashiyamamoodyz divaMIDE-916MIDE916mide00916
    • 2021-05-08
    241 min

    [UMSO-393]Shaved Girl WIth Small Tits Creampied - 9 Girls

  • yukari miyazawa hina morikawa censoredcreampieUMSOkm produceumanamiUMSO-393UMSO393umso00393
    • 2021-05-17
    35 min

    FC2PPV 1823111 Up to 24 980 [No] Juniors with fair-skinned beautiful breasts and good sensitivity. ○ Let me bring it to the room, ejaculate in the raw vagina and hit the uterus directly with a hat trick.

  • amateur uncensoredfc2
    • 2021-05-20
    243 min

    [CVDX-449]A Mature Woman Is Squeezing The Life Out Of My Ecstatic, Rock Hard Cock, With Piston-Pounding Creampie Sex So Good It Makes My Brain Melt, As I Sank Into A Twisting, Sloppy, Swamp Of Orgasmic Pleasure. 40 Ladies 4 Hours

  • censoredcreampiemarried womanCVDXcenter villageCVDX-449CVDX449h-086cvdx00449
    • 2021-05-23
    116 min

    241GAREA-512 Suwan

  • amateur censoredamateurbeautiful girlgareagarea-512garea512241garea-512
    • 2021-06-12
    116 min

    [VENX-047]Stepmom Tempts Her Stepson Whith Whispers, So His Father Does Not Notice - Chitose Yuki

  • chitose in the evening censoredcreampiebig titsVENXvenussarufakecest winntersVENX-047VENX047venx00047
    • 2021-06-25
    16 min

    FC2PPV 1887065 [Discontinued] (Leaked) Gravure H crazy for a man I’m squirming my penis every day at a rental apartment [Caution to delete]

  • amateur uncensoredfc2
    • 2021-07-01
    50 min

    1Pondo 070121_001 The Throbbing: Date with Nanako after childbirth Nanako Asahina

  • amateur uncensored1pondo
    • 2021-07-06
    32 min

    493NAEN-084 1 liter of tide! ？？ De M college student! ？？ If you poke it, just poke it and the tide will pop out Sensitive Ma ○ Ko and Gonzo Morishita Mirei

  • amateur censoredamateurbeautiful girlnaennaen-084naen084493naen-084
    • 2021-07-24
    37 min

    [PSST-028]Young Married Beauty Makes Her Porn Debut! Beautiful European Woman's First Time Having Sex On Camera! Cindy

  • censoredmarried womanamateurPSSTpatzkin amateurbooker tPSST-028PSST028h-1450psst00028
    • 2021-08-12
    16 min

    HEYZO 2585 Erotic Massage For Sara – Sara Yurikawa

  • sara yurikawa uncensoredblowjobhandjobheyzo
    • 2021-09-03
    217 min

    [DVDMS-711]A Normal Boys And Girls Focus Group Adult Video In This Special Edition, We Follow A Clan That Fucks Together, And Watch Happens Afterward On The Other Side Of That Magic Mirror Is Her Loving Stepfather! A Big Tits Stepmom And Sch**lgirl L

  • censoredcreampieamateurDVDMSdeepspoolsideDVDMS-711DVDMS711dvdms00711
    • 2021-09-06
    53 min

    292MY-499 Nakanishi Misuzu 1

  • amateur censoredmarried womanamateurmymy-499my499292my-499
    • 2021-09-08
    58 min

    SIRO-4621 [First Shot] [Dada Leaked Eros] [Enchanted F Milk] A Flower Coordinator With A Strong Libido Who Exudes Erotic From The Looks Has Appeared. A Superb Body That Has Been Captivated By Many Males Straddles A Big Cock And Makes A Tremendous Eff

  • amateur censoredbig titsamateursirosiro-4621siro4621siro-4621
    • 2021-09-10
    115 min

    [JUL-701]Helpless And Restricted Cherry Boy Can Only Get A Word Out While Virginity Is Taken. Honoka Yonekura

  • hoika yonekura censoredmature womanslutJULmadonnahiroyuki kimuraJUL-701JUL701jul00701
    • 2021-09-11
    133 min

    [CEAD-361]I Am A Pleasure-mad Nasty Maturbator 20 - Rin Kira

  • kira rin censoredmature womansingle workCEADserebu no tomoCEAD-361CEAD361cead00361
    • 2021-09-23
    26 min

    FC2PPV 2241339 Unauthorized Vaginal Cum Shot To A Beautiful Ass Young Wife

  • amateur uncensoredfc2
    • 2021-10-29
    66 min

    530DG-029 [Voyeurism In The Fitting Room] Stupor Video ＃ 1

  • amateur censoredcreampiebig titsdgdg-029dg029530dg-029
    • 2021-10-29
    87 min

    [FTHT-026][Jungle Hair! Thick Love Juices! Tropical Wet Forest! Oily Body Fluids! Infinite Cumming! Complete Carnivore For A Full Lolita] It Won"t Fit In Her Panties! It Can"t Stay In! All-you-can-eat Pubic Hair! Natural Bone For A Naturally

  • censoredcreampieFTHTfaleno tubedavielFTHT-026FTHT0261ftht00026
    • 2021-11-03
    73 min

    534IND-008 Creampie In A Neat And Serious Yariman Beautiful Girl, P Activity Outflow Of A Character Chen Fornication Beautiful Girl With Fingering Ww

  • amateur censoredcreampiebig titsindind-008ind008534ind-008
    • 2021-11-04
    110 min

    [STSK-004]Peeping on People Next Door Two People 23 School Visits/Rooms 8 Days

  • censoreduniformamateurSTSKshirouto 39STSK-004STSK004h-1605stsk00004
    • 2021-11-17
    69 min

    FC2PPV 2441352 Hold 3 Times Until Registration! !! Midnight [Don Quixote Musume] I Was Stunned By A Large Number Of Facial Cumshots At A Hotel When I Was Called By An Unknown Elderly Person …

  • amateur uncensoredfc2



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download