southern earth




FC2SDABAMBIAUKSBBANSSNINNPJJUFECAWDSSISMIDVATIDSQTEHMNDASDSTARSMEYDHUNTBMILKSPRDNATR

2020-12-11
47 min

[NTTR-057]The Possessed Idiot Tensions Are Explosively High!!!!! It's 200 Million Percent Fucked Up LOL We're Busting Girls And Boys And Convenience Stores!!!!! The Extreme Second Part Mitsuki Nagisa

  • scooping censoredNTTRsod createota migiwaknotriNTTR-057NTTR0571nttr00057
    • 2020-12-17
    212 min

    [MADV-501]Beautiful Tits, Soft Tits, Colossal Tits - They're All Busty Babes! Prestigious College Girl Orgasmic Creampie Sex - Part-Time POV

  • ena koume rino osaka censoredcreampiebig titsMADVcrystal picturetatsuno kumataromaniac crystalMADV-501MADV50149madv00501
    • 2021-01-07
    92 min

    AVKH-189 Shiori Sawada

  • amateur censoredbig titsamateuravkhavkh-189avkh189avkh-189
    • 2021-01-15
    240 min

    [MBM-259]"Let's Keep This A Secret From Your Stepdaddy..." When A Stepmom Bares Her "True Identity As A Woman" Our Stepdaddy Is Unaware Of Our Secret A Stepmom And Stepson, Engaged In A Forbidden Sexual Rhapsody 12 Ladies 4 Hours

  • censoredbig titsmature womanMBMprestigegaro sasazukambmMBM-259MBM259118mbm00259
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-29
    52 min

    FC2PPV 1642927 [Personal shooting] Ami 21 years old G cup big tits black hair long JD licks the whole body and cums a lot of super big dicks! !!

  • amateur uncensoredfc2
    • 2021-02-06
    597 min

    [OFJE-296]Mixed Body Fluids, Deep Sex - Latest 12 Titles, 51 Scenes, Complete 10-Hour BEST Collection

  • nanatsumori riri kodama rena censoredbig titsOFJEs1 no 1 styleOFJE-296OFJE296ofje00296
    • 2021-02-15
    134 min

    [PTYH-002]Immediately Fucking A Married Womman With A Loose, Sloppy Body For Continuous Creampie Sex

  • censoredcreampiebig titsPTYHpetersPTYH-002PTYH002h-021ptyh00002
    • 2021-02-18
    240 min

    [DVDMS-631]Finally Ready For A Facial! One-Way Mirror Cab - Office Girls With Perky Asses Working For Top Corporations In Pants Suits Edition - Squeezing Their Fine Booty Encased In Tight Workwear Makes Their Elite Pussies Wet For Huge Cocks! In Ginz

  • censoredamateurDVDMSdeep sfunky hasegawathe magic mirrorDVDMS-631DVDMS631dvdms00631
    • 2021-02-19
    118 min

    [KUM-013]Undercover Female Detective 02

  • censoredbig titsbdsmKUMprestigejanhirokyuryu prestigeKUM-013KUM013118kum00013
    • 2021-02-19
    126 min

    [AEG-012]Outdoors S&M: Exhibitionist Education - Kanon Mira VS Kurumi Mira

  • censoredbdsmAEGprestigehideki hormonaegean prestigeAEG-012AEG012118aeg00012
    • 2021-03-06
    202 min

    [DVDMS-637]The Magic Mirror Number Bus Special Edition These 2 Adult Video Actresses Are Best Friends And Taking The "Bring Your Hearts Together And Escape" Game, Together! Choose From One Of The Following: Kissing/Titty Fondling/Big Vibrator

  • censoredcreampieblowjobDVDMSdeep sgreenhouse effectthe magic mirrorDVDMS-637DVDMS637dvdms00637
    • 2021-03-19
    190 min

    [DOCP-280]"I'll Do Anything You Need Me To, Okay？" I Got Laid Up From An Injury And My Younger Stepsister Was Left To Bathe Me! I Got Hard When She Cleaned Under My Stuck Foreskin, And This Made Her So Horny That She Couldn't Hide It

  • moe hazuki saya matsui censoredcreampiebig titsDOCPprestigedoc premiumDOCP-280DOCP280118docp00280
    • 2021-03-31
    43 min

    292MY-450 Rin Fujisaki 2

  • amateur censoredcreampiemarried womanmymy-450my450292my-450
    • 2021-04-03
    85 min

    [VENX-022]Once A Month Sex With My Step Son Looking Forward To Being Fucked Again Yui Sasaki

  • yui sasaki censoredcreampiemature womanVENXvenuskaniefakecest winntersVENX-022VENX022venx00022
    • 2021-04-08
    122 min

    [FSDSS-203]Cumming For The First Time! 4 Orgasms Super Beautiful Girl All Sex Special Momo Honda

  • honda peach censoredsquirtingblowjobFSDSSfalenomusetafaleno starFSDSS-203FSDSS2031fsdss00203
    • 2021-04-18
    27 min

    FC2PPV 1776135 [4K] [Individual shooting] Suzu-chan 20 years old part19 4K version part 4

  • amateur uncensoredfc2
    • 2021-04-20
    136 min

    [STARS-353]A Coed Bathing Employee Trip NTR My Colleagues Love To Hit The Bathhouse, So We Went To A Private Bath And That's Where I Saw My Wife Getting Her Brains Fucked Out ... Suzu Honjo

  • suzu honjo censoredcreampiesingle workSTARSsod createamazing meatsod starSTARS-353STARS3531stars00353
    • 2021-04-22
    255 min

    [SVDVD-853]One-Way Mirror Cab: Hard-Boiled - These S********l Tik Tok-ers From The Country Can Win Travel Expenses And Prize Money After Being Stuck At Home Without Field Trips Or Even Graduation Ceremonies Due To Social Distancing - Now That It'

  • censoredcreampiesquirtingSVDVDsadistic villagenew kazi kazamamagic mirror sadistic villageSVDVD-853SVDVD8531svdvd00853
    • 2021-05-03
    48 min

    498DDH-012 [NTR] Cuckold the sexy body of the baby face in front of her boyfriend … A friend and her girlfriend who got drunk by drinking at home and fell asleep with small fish [Voyeurism]

  • amateur censoredamateurbeautiful girlddhddh-012ddh012498ddh-012
    • 2021-05-08
    52 min

    C0930 hitozuma1355 Mio Taira 26years old

  • amateur uncensoredc0930
    • 2021-05-22
    148 min

    [JUKF-062]Ripe Young Fruit Hikaru-chan Hikaru Minazuki

  • hikaru minazuki censoredcreampiesingle workJUKFjumpjump avJUKF-062JUKF062h-227jukf00062
    • 2021-06-10
    120 min

    [GS-390]Exchanging Passionate Kisses With A Female Coworker Who Loves To Lavish You With Her Lips! To Save Money, The New Employee Welcome Party Is Being Held At The Office This Year, And A Little Liquor Makes Things Get Wild... This New Hire Wants T

  • censoredGSsosoru x garcontumblerGS-390GS3901gs00390
    • 2021-06-11
    151 min

    [MIAA-452]When Old Guys Make Strange Noises When You Tease Their Nipples, Shut Them Up With A French Kiss! Ichika Matsumoto Asuka Momose

  • ichika matsumoto momose asuka censoredschoolgirlslutMIAAmoodyzgoemoneveryone s porn starMIAA-452MIAA452miaa00452
    • 2021-06-12
    121 min

    [APKH-176]A Sex Trip Where I Was Invited By Miss Campus, A Girl With Super Hard, Beautiful Nipples. The Sexual Service I Got At This Hot Springs Resort Made My Love Juices Flow Out In Thin Strings Karen Asahina

  • karen asahina censoredcreampiesingle workAPKHaurora project annexhaurora project anexAPKH-176APKH176apkh00176
    • 2021-06-13
    17 min

    10musume 061321_01 Secret Pussy Collection: Anna Arimura

  • amateur uncensored10musume
    • 2021-06-18
    57 min

    FC2PPV 1875700 [No / Piece] Discover the finest amateur girl! When I took off the adult-looking Lori face JD, it was a dirty body with F cup big breasts! After enjoying the elastic smooth skin, a large amount of vaginal cum shot! !! * There is an app

  • amateur uncensoredfc2
    • 2021-06-25
    120 min

    [CLUB-645]I've Been D***king My Stepmom's Breast Milk Daily For 20 Years, And Now She Has Agreed To Relieve Me Of My Ball Juices...

  • censoredcreampieCLUBhentai shinshi clubCLUB-645CLUB645club00645
    • 2021-07-09
    101 min

    [shinki-047]M47ちゃん

  • amateur censoredcreampieamateurshinkishinki-047shinki047shinki-047
    • 2021-07-14
    65 min

    495MOJ-011 "riko & Arisa" Of A Good Friend Duo With A Lesbian After School Orgy

  • amateur censoreduniformamateurmojmoj-011moj011495moj-011
    • 2021-07-18
    243 min

    [NASH-544]Horny Mature Women! Works Carefully Selected By Our Stuff ! Piss Juices Overflowing To The Max! You Will Definitely Get Off! 4 Hours Of Older Women Having Thick, Rich Sex

  • censoredcreampiebig titsNASHnadeshikoNASH-544NASH544nash00544
    • 2021-08-13
    230 min

    [HUNTB-075]If You Do Me, I"ll Do You! [I Can"t Do It Anymore!] [It"s Totally Not Enough!] The Sister-In-Law Who Can"t Help But Climax!

  • censoredcreampieblowjobHUNTBhuntervolvo nakanohhh groupHUNTB-075HUNTB075huntb00075
    • 2021-08-26
    125 min

    [HBAD-593]I Am Weak-willed, I Can"t Refuse... A Compliant Wife With Colossal J-cup Tits And A Soft Body - Hana Himesaki

  • himesaki hana censoredbig titssingle workHBADhibinorokutanzono seishibabeHBAD-593HBAD5931hbad00593
    • 2021-09-24
    101 min

    [YSN-559]My New Sister-In-Law Is A Devil, But My Erection Doesn"t Go Away. Mao Hamasaki

  • hamazaki mao censoredcreampieblowjobYSNnonYSN-559YSN559h-127ysn00559
    • 2021-09-28
    77 min

    418YSS-89 ​​Yui (Yui Nagase)

  • amateur censoredamateurcosplayyssyss-89yss89418yss-89
    • 2021-10-02
    139 min

    [PKPD-165]An 18-Year-Old Who Is OK With A Creampie During Compensated Dating. A Girl Who Is A Refined Gal From A School For Young Ladies. Reona Tomiyasu

  • takehiro tomiyasu censoredcreampieschoolgirlPKPDpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPD-165PKPD165pkpd00165
    • 2021-10-06
    55 min

    FC2PPV 2304441 [Women Who Deliver Fluffy] Genki Max (20 Years Old) Kansai Dialect Idol (20 Years Old) Supporters 20,000 Class! Dance Big Breasts Liver At The Distributor Off Party After Pool Gonzo Creampie Personal Shooting [Caution: Strictly Forbidd

  • amateur uncensoredfc2
    • 2021-10-13
    47 min

    FC2PPV 2340408 [New Work, Half Price! ] ♀206 Female College Student Me ◯ -Chan 19 Years Old 9th Time Continues Until She Gets Pregnant! Aiming For The Second Unwanted Pregnancy In Av Shooting, A Big Shot Of Thick Semen In A Genuine Raw Vaginal Cum Sh

  • amateur uncensoredfc2
    • 2021-10-18
    65 min

    541AKYB-027 Aika (24) Kansai People Who Love H Will Soon Be Flooded ♪

  • amateur censoredcreampieamateurakybakyb-027akyb027541akyb-027
    • 2021-10-19
    58 min

    230OREC-900 Mr. Hoshitani (Hitomi Hoshitani)

  • amateur censoredcreampieamateurorecorec-900orec900230orec-900
    • 2021-10-24
    71 min

    200GANA-2585 Seriously Nampa, First Shot. Picking Up 1707 H-Cup Big Breast Nursery Teachers! Maybe It’s Because I’m Tipsy That I Don’t Get Angry Even If I Touch My Boobs, Or Maybe It’s Because Of My Sexual Desire … Sensitive

  • amateur censoredbig titssquirtingganagana-2585gana2585200gana-2585
    • 2021-11-13
    35 min

    FC2PPV 2430188 [New Work, Half Price! ] ♀43 Professional Student Mi ◯ -Chan 19 Years Old, ♀ 206 Female College Student Me ◯ -Chan 19 Years Old 5th Time (3p) Creampie Orgy

  • amateur uncensoredfc2
    • 2021-11-15
    62 min

    FC2PPV 2421391 [Tsundere Lewd] Tsubasa ★ Super Beautiful Breasts Lewd Older Sister Defeats M-Type Uncle And Relieves Stress W. Amazing Blowjob Amazing Fucking ♪ Cowgirl That Is Too Intense And Too Erotic. Dere-The Sweetness Of Time Is Endlessly Cute

  • amateur uncensoredfc2
    • 2021-11-21
    83 min

    200GANA-2598 Seriously Nampa, First Shot. 1718 The Gestures And The Way Of Speaking Are Cute One By One! Bring The Girl’s Bar Clerk Who Is Calling In Shibuya To The Hotel! Beautiful Breasts X Nice Ass God Body On Pure White Skin! Inevitable Love

  • amateur censoredamateurganagana-2598gana2598200gana-2598
    • 2021-12-05
    57 min

    413INST-189 [Idol Trainee Belonging To A Certain Art Professional] God-Friendly Private Gonzo Leaked Celebration 20-Year-Old Drinking Copulation Orthodox Beautiful Girl Squirting While Being Disturbed By Raw Sex Messed Up Personal Shooting (Ayano Suz

  • amateur censoredcreampiesquirtinginstinst-189inst189413inst-189
    • 2021-12-07
    57 min

    FC2PPV 2496961 * Limited Time Price Until 12/13 [2480pt⇒1980pt] Pink Nipples & Slimy Pussy Juice ☆ Unfussy Fair-Skinned Beautiful Girl (18) ☆ When I Inserted It Slowly Raw, The Wall Was Sticking. [cen]

  • amateur uncensoredfc2
    • 2021-12-19
    37 min

    FC2PPV 2526936 [Uncensored] The Highest Style! I Was Able To Spend A Rich Time With The Glamorous Beauty Of The Estimated G Cup (Impressive) Really The Best Vaginal Cum Shot (Crying)

  • amateur uncensoredfc2
    • 2021-12-24
    68 min

    OREX-330 Fuwari-chan 2 (Hino Fuwari)

  • amateur censoredcreampiebig titsorexorex-330orex330orex-330



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download