sod create




FC2AUKGAVSAKSBJPPPDKBINATRMIDEGMEMATIDROYDCESDGVHSQTEMIAASSNINACRMILKADNHZGDEBOD

2020-12-29
17 min

HEYZO 2426 Manaka’s Orgasms with Toys – Manaka Shibuya

  • manaka shibuya uncensoredblowjobheyzo
    • 2020-12-31
    64 min

    413INST-083 [Following Erica] Japan’s worst gravure idol decision. The scene of private 3P sex of H cup innocent school idols rising idol is covered with tide and sperm of annoying screaming

  • amateur censoredcreampiebig titsinstinst-083inst083413inst-083
    • 2021-01-07
    59 min

    [loli-032]いずみ

  • amateur censoredcreampieschoolgirlloliloli-032loli032loli-032
    • 2021-01-15
    80 min

    FC2PPV 1646453 [First time limited 1980] Club picked up club love active JD ❤️ I was allowed to take a gonzo when I was in contact ❤️ Full erection with self-Irama ❤️ A large amount of vaginal cum shot with a meat stick woofer ❤️

  • amateur uncensoredfc2
    • 2021-01-16
    240 min

    [HUNTA-937]"The Truth Is, I'm A Serious Slut!" This Prim And Proper Girl Is Actually Super Horny And Into Passionate, Deep And Rich Sex!! In Any Case, She Loses Her Mind With Liberating, Deep And Rich Sex!

  • censoredcreampieblowjobHUNTAhuntervolvo nakanohhh groupHUNTA-937HUNTA937hunta00937
    • 2021-01-17
    119 min

    [DDHH-024]Suffocation, Confinement, Barely Legal - Sara Kanami

  • kagami sara censoredcreampiedeepthroatDDHHdogmahidekiDDHH-024DDHH024ddhh00024
    • 2021-01-29
    44 min

    [fan-097]あいる

  • amateur censoredbig titsamateurfanfan-097fan097fan-097
    • 2021-02-05
    41 min

    480FRIN-018 《Personal shooting / Hidden shooting》 Women’s cosmetics manufacturer advertising model [SH] Sexual entertainment tall stature leaked

  • amateur censoredcreampieamateurfrinfrin-018frin018480frin-018
    • 2021-02-05
    60 min

    [PARATHD-3096]Picking Up Girls Who Came To Tokyo On An Overnight Bus (2) - Meari From Hiroshima (24)

  • censoredbig titsamateurPARATHDparadise tvPARATHD-3096PARATHD3096parathd03096
    • 2021-02-18
    149 min

    [PPPD-905]My Girlfriend's Older Sister Tempts Me With Her Big Tits, Telling Me It's OK To Creampie Her - Ranka

  • ranka censoredcreampiebig titsPPPDoppaiPPPD-905PPPD905pppd00905
    • 2021-02-19
    240 min

    [MBM-271]Is Your Wife OK？! She'd Cheat With Somebody Like This？! This Is Unbelievable... Prim, Pretty, Shy, And Serious Wives Have Cheating Creampie Sex Vol. 3 12 Girls, 4 Hours

  • censoredcreampieamateurMBMprestigembmMBM-271MBM271118mbm00271
    • 2021-02-26
    51 min

    380SQB-090 Minami

  • amateur censoredbig titsamateursqbsqb-090sqb090380sqb-090
    • 2021-02-28
    149 min

    [DBER-102]Sinking To The Depths Of Hell - Their Agony Is Exposed As Their Eyes Roll Back And They Spasm As They Cum - RED BABE ULTRA MOVIES

  • censoredbdsmDBERbabyentertainmentredDBER-102DBER102dber00102
    • 2021-03-06
    124 min

    [NGOD-145]In Order To Help Her Family Out, This Housewife Started Doing Temp Work For This Company, And While She Was Still On Her Probationary Period, Her Horny Boss Took Notice Of Her And Hired Her To Satisfy His Sexual Needs ... Honoka Tsujii

  • tsujii honoka censoredsingle workNGODjet eizomanji groupNGOD-145NGOD145ngod00145
    • 2021-03-12
    117 min

    [HONB-210]She's A Broadcast-Everything-Type, But She's Still A Gal, And She Has Big Tits, But She's Still A Virgin

  • censoredbig titsHONBmercurythe first shibuya special f e headquarHONB-210HONB210h-1133honb00210
    • 2021-03-21
    88 min

    490FAN-077 Yuria

  • amateur censoredmarried womanamateurfanfan-077fan077490fan-077
    • 2021-03-21
    73 min

    200GANA-2455 Seriously Nampa, first shot. 1612 Bed in with a beautiful woman who is worried that "I haven’t gotten along with my boyfriend …" !! The cowgirl with a nice rhythm by a serious Imadoki beauty was too erotic! !!

  • amateur censoredbig titssquirtingganagana-2455gana2455200gana-2455
    • 2021-03-25
    121 min

    [RCTD-391]Dirty Talking Female Anchor, 25 Years Old: A Female Announcer With Crazy Habits SP - Sei Maihara

  • kiyoshi maihara censoredbig titssingle workRCTDrockettaro kanbeRCTD-391RCTD3911rctd00391
    • 2021-04-18
    88 min

    345SIMM-636 Play outdoors with Hajimete’s remote control rotor! "Jin Jin …" It feels a little regrettable to feel with toys (laughs) Pleasure SEX with future bride candidates who tend to be jealous! !! [Special day for Suzu-chan (gi

  • amateur censoreduniformschoolgirlsimmsimm-636simm636345simm-636
    • 2021-04-23
    53 min

    [WFR-015]Sharing A Room With My Awful Boss - Her Delicate Body Manhandled While She's Ravished Runa Tsukino

  • tsukino luna censoredsquirtingdeepthroatWFRwaap entertainmenttonkatsuwWFR-015WFR0152wfr00015
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-01
    160 min

    [DVDMS-662]Smoking Hot Airport Security Guard Yuiko (Age 23) Makes Her Porn Debut - And Loses Her Virginity On Camera! A Working Girl's Porn Performance - This Slender, Toned Babe Has Defined Abs - 307 Days Of Passionate SEX

  • censoredamateurDVDMSdeep shikaru kamegashiraDVDMS-662DVDMS662dvdms00662
    • 2021-05-13
    62 min

    515BTGL-004 Kaho

  • amateur censoredcreampiebig titsbtglbtgl-004btgl004515btgl-004
    • 2021-05-14
    164 min

    [JJBK-043]MILFs Only - Hidden Camera Voyeur Footage Of Cougars Brought Home For A Fuck Secret Sold As Porn 41 - Mature Sluts In Their Forties With Dripping Snatches Take Raw Creampies Edition - Misaki, P-Cup, Age 42, Colossal Tits Flopping While She

  • censoredmature womanslutJJBKjukujo bank emmanuellemanji groupJJBK-043JJBK043jjbk00043
    • 2021-05-15
    55 min

    383REIW-065 Ren

  • amateur censoredcreampiebig titsreiwreiw-065reiw065383reiw-065
    • 2021-05-20
    88 min

    [YOZ-386]Gorgeous Call Girl Delivered To Your Door 2

  • censoredbig titslingerieYOZstar paradiseyaozokuYOZ-386YOZ386h-254yoz00386
    • 2021-05-22
    241 min

    [BDSR-449](True Stories) Hidden Camera Peeping At Midnight! How Did This Happen？! Wives With A Reason To Cheat Take Secret Part Time Jobs - Every Steamy Detail! 15 Hot Amateur Married Women 4 Hours

  • censoredcreampieamateurBDSRbig morkalBDSR-449BDSR44957bdsr00449
    • 2021-05-28
    150 min

    [CLUB-641]Just Accept It An Angel In Uniform With Light Skin And Delicious-Looking Thighs Is Luring You To Full Panties Temptation So You Can Have All The Sweaty Sex You Can Handle

  • censoreduniformCLUBhentai shinshi clubCLUB-641CLUB641club00641
    • 2021-06-04
    120 min

    [NGOD-149]Being Felt Up By A Millionaire...Wife With Big Tits Gets Fucked By A Charismatic Investor Hana Haruna

  • haruna hana censoredbig titsmature womanNGODjet eizomanji groupNGOD-149NGOD149ngod00149
    • 2021-06-04
    62 min

    520SSK-006 Saki

  • amateur censoredamateurbeautiful girlsskssk-006ssk006520ssk-006
    • 2021-06-11
    430 min

    [KRU-118]Nice Married Masseuse In A Massage Parlor Without A Happy Ending Smiles And Does It Anyway If You Ask Her!

  • censoredcreampiebig titsKRUkarmamanji groupKRU-118KRU118kru00118
    • 2021-06-12
    120 min

    [NATR-659]Father Fucks His Son's Wife In His Fantasies Nanako Miyamura

  • nanako miyamura censoredcreampiemature womanNATRnadeshikobito sakuraNATR-659NATR659natr00659
    • 2021-07-01
    55 min

    324SRTD-0236 Raw Saddle Into G Cup Girls With 2 Experienced People I Met On SNS!

  • amateur censoredcreampiebig titssrtdsrtd-0236srtd0236324srtd-0236
    • 2021-07-02
    64 min

    328HMDN-378 J Cup Big Breasts Wife 27 Years Old Free Massage Picking Up Girls On SNS For Married Women Who Are Worried About Stiff Shoulders. Pretending to be a serious treatment, pleasure fell in 5 minutes with an aphrodisiac. The unstoppable Portio

  • amateur censoredcreampiebig titshmdnhmdn-378hmdn378328hmdn-378
    • 2021-07-06
    31 min

    493NAEN-082 Sleep ○ Fuck! ？？ Sleeping Gonzo! ？？ Minimum Saffle and Good Morning Sex & Creampie Miho Sakasaki

  • amateur censoredamateurbeautiful girlnaennaen-082naen082493naen-082
    • 2021-07-07
    52 min

    PWIFE-754 Sara

  • amateur censoredcreampiebig titspwifepwife-754pwife754pwife-754
    • 2021-07-14
    163 min

    [BLK-507]Convenient Free Pussy! Fucking Raw Till Morning With A Horny Bitch Who Loves Older Men 06

  • censoredcreampiebig titsBLKkira kirakira kira black galBLK-507BLK507blk00507
    • 2021-08-12
    56 min

    10musume 081221_01 An Office Lady With Outstanding Style Wear A Swimsuit Miki Inoue

  • amateur uncensored10musume
    • 2021-08-28
    47 min

    519MAZOF-013 [Don’t Stand On The Podium! ] C School Female Teacher 28 Years Old [Hentai Civil Servant] If You Hit Your Ass, You Will Cry With A Good Voice. Forbidden Sexual Intercourse That Goes Crazy With A Devil Piston

  • amateur censoredamateurmazofmazof-013mazof013519mazof-013
    • 2021-09-03
    122 min

    [JUTA-121]The Best!! An AV Document Of The First Undressing Of A Fifty-Something-Year-Old Wife, Akari Maya

  • shinya akari censoredcreampiemature womanJUTAjuku onna japan emmanuellekongouriki marujuku onna japanJUTA-121JUTA121juta00121
    • 2021-09-17
    151 min

    [PRED-336]Holy Water, D***k My Body Fluids, Bathe In It Yuki Takeuchi

  • yuki takeuchi censoredcreampiesquirtingPREDpremiumdoragon nishikawaelegancePRED-336PRED336pred00336
    • 2021-09-19
    115 min

    [083PPP-2240]SEX大好きお姉さん10人！あまりにもエロいので思わず中●ししちゃいました(6)

  • amateur censoredamateurpppppp-2240ppp2240083ppp-2240
    • 2021-10-02
    250 min

    [YMDD-244]Debut While Watching A Shooting -Their Pussies Gets Wet From Others Fucking, And They Can"t Take It-

  • hotaru mori censoredcreampiebig titsYMDDmomotaro video publishinghimrockyoung peachYMDD-244YMDD244ymdd00244
    • 2021-10-08
    162 min

    [DASD-921]Reverse Cosplay For Full Exposure With A Bold Harlem Slut. Minami Hatsukawa

  • hatsukawa minami censoreduniformcosplayDASDdasmasaki naoDASD-921DASD921dasd00921
    • 2021-10-28
    122 min

    [NTRD-095]The Cuckolders Who Would Have Thought That She Was Fucking My Employee ... Kasumi Ikeya

  • kazumi ikeya censoredmature womansingle workNTRDtakara eizoutakara hiroshine tou kaiNTRD-095NTRD09518ntrd00095
    • 2021-11-01
    119 min

    [MARA-062]Hana Haruna Colossal Tits KCups! 108cm

  • haruna hana censoredcreampiebig titsMARAplanet plusdirector omarakasuMARA-062MARA062h-237mara00062
    • 2021-11-05
    80 min

    483SGK-051 [Large Climax That Trembled In The United States] [Creampie In Rage & Super Facial Cumshot] [The Biggest Impact Of The Year] [* Be Careful Too Much *] The Climax Next To The Trembling Climax In The United States! !! !! The Climax Child

  • amateur censoredcreampiesquirtingsgksgk-051sgk051483sgk-051
    • 2021-11-08
    72 min

    498DDH-043 I Will Allow Vaginal Cum Shot Without Permission! Flirting At Home With A Fluffy Healing Sister … "This Is No Good ♪" Raw Sex That Keeps Being Spoiled While Being Gently Scolded! From … Punishment Nipple Groping X Cowgirl

  • amateur censoredcreampieamateurddhddh-043ddh043498ddh-043



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download