soav




FC2STARSBBANHODVAUKGPREDFSDSSDASDSSNIKBIAUKGNATRMVSDSQTENACRMIDVSPRDCAWDADNHUNTBSHKD

2020-12-04
128 min

[ABW-030]Godly Orgasms 2nd All Real Tied Up Climax Hell Maria Aine

  • maria aine censoreddeepthroatsingle workABWprestigeshiko tissue fuwafuwaabsolutely wonderfulABW-030ABW030118abw00030
    • 2020-12-04
    74 min

    300MAAN-606 [Popular Paipan Cram School Lecturer / Brush Wholesale / Suit SEX] Haruna-chan, a cool beauty female college student who aims to become a teacher! !! If such a child becomes a teacher, there is no doubt that the popularity of boys will ex

  • amateur censoredamateurcosplaymaanmaan-606maan606300maan-606
    • 2020-12-06
    80 min

    200GANA-2396 Seriously Nampa, first shot. 1564 Secure a female college student who told me that she was in trouble (pretending to be the wind) because her bicycle saddle was stolen! As I approached her kindness, I gradually forgave my body …

  • amateur censoredsquirtingamateurganagana-2396gana2396200gana-2396
    • 2020-12-20
    30 min

    FC2PPV 1613260 A beautiful nurse model shooting a lascivious shaved pussy sticking to a cock and a cock is stimulated, … [Amateur individual shooting original FHD high quality ZIP download available]

  • amateur uncensoredfc2
    • 2020-12-27
    143 min

    [KTKZ-081](Shocking Amateur Videos) Chiharu Is A Reverse Pick Up Tuber Who Loves To Kiss We Seduced Her And Fucked This Slut, Along With All The Other Residents Of Her Shared Living Community House "When I Start Kissing, My Pussy Gets Dripping We

  • censoredamateurslutKTKZkitixx mousouzokushinjinKTKZ-081KTKZ081ktkz00081
    • 2020-12-27
    140 min

    [KNAM-031]Totally Raw Three-Way: Yui & Chiharu - # Creampie Compensation Dating Three-Some At A Love Hotel - Innocent-Looking Slut Yui x Shy Sub Chiharu

  • censoredcreampieuniformKNAMfirst star100 raw styleKNAM-031KNAM031h-491knam00031
    • 2020-12-31
    118 min

    [SSNI-958]Stuck At School Overnight With The Teacher I Hate Because Of A Storm... It's Just The Two Of Us And My Clothes Are Soaked - The Gross Old Perv Can See Everything - But There Was Nowhere Else To Go, So He Wound Up Fucking Me Until I Came

  • kodama rena censoredbig titsuniformSSNIs1 no 1 styletrendy yamaguchiSSNI-958SSNI958ssni00958
    • 2021-01-01
    200 min

    [FCH-070]Exclusive - When She Breaks Out Her Sexy Tongue Techniques And Deep Kisses You While She's Giving You A Handjob, You Know It's Time To Cum! 5

  • ichika matsumoto kira ri censoredbeautiful girlhandjobFCHprestigefetish partyFCH-070FCH070118fch00070
    • 2021-01-10
    146 min

    [NSPS-959]By Someone You Can't Stand... -My Wife Creampied By Aggressive Guys - Momoe Takanashi

  • momoe kotori censoredmature womansingle workNSPSnagae stylejotaro tomiNSPS-959NSPS959nsps00959
    • 2021-01-14
    52 min

    FC2PPV 1644875 [First shot] I exposed my erotic face and shook my hips crazy, and I made a lot of vaginal cum shot to a glamorous mature woman with a brown body who leaked continuously www ♥♥

  • amateur uncensoredfc2
    • 2021-01-15
    120 min

    [REAL-756]All I Could Do Was Watch As My Girlfriend Got Fucked By My Own Father And Gradually Became His. Nana Maeno

  • nana maeno censoredschoolgirlsingle workREALreal worksjohnny shibuyareal real worksREAL-756REAL756172real00756
    • 2021-01-23
    127 min

    [IKST-010]If You Want To Get Your Nookie With A Sexy Elder Sister Type, This One's For You! Mio Kayama Best Hits Collection Super Selections Just For You! Lots Of Super Rare Scenes In This Collection Of Premium Selections!

  • kayama yoshisakura censoredcreampiebig titsIKSTsuddenly eroticIKST-010IKST010h-1454ikst00010
    • 2021-01-29
    51 min

    [fan-101]れい

  • amateur censoredbig titsamateurfanfan-101fan101fan-101
    • 2021-02-18
    61 min

    413INST-097 [Female college student, orgy 5P individual shooting] Baptism of seeding in the city to a pure innocent Tokyo girl! The taste of the man I knew for the first time was too pleasant and the reason was blown away! One after another, I was st

  • amateur censoredcreampiebig titsinstinst-097inst097413inst-097
    • 2021-02-23
    144 min

    [KUSE-007]Slender Mysterious Girl With A C***dlike Face And Small Breasts Super Masochistic Government Worker Inori Sasage Porno Debut

  • dedication glue censoredamateurdeepthroatKUSEsodevening publicationtheKUSE-007KUSE0071kuse00007
    • 2021-03-12
    80 min

    453SSAN-020 Midnight Sex With Ai-san.

  • amateur censoredbig titsamateurssanssan-020ssan020453ssan-020
    • 2021-03-13
    49 min

    C0930 hitozuma1350 Sae Nanmoku 26years old

  • amateur uncensoredc0930
    • 2021-03-13
    121 min

    [MUDR-143]My Little Stepsister Is A Cute GAL Real Edition My Little Stepsister Wants To Cuddle. Momo Kato ka

  • kato momoka censoredcreampiesquirtingMUDRmukuMUDR-143MUDR143mudr00143
    • 2021-03-16
    50 min

    H0930 ki210316 Ryoko oe 40years old

  • amateur uncensoredh0930
    • 2021-03-25
    52 min

    230ORETD-855 Kurokawa-san

  • amateur censoredcreampieuniformoretdoretd-855oretd855230oretd-855
    • 2021-04-02
    180 min

    [PRED-302]Wallowing In Shame, Sweat, And Body Fluids...Licking Instinct And Kissing Orgasms Kano Kashii

  • kashii hanano censoredcreampiesquirtingPREDpremiumcaptain eharaelegancePRED-302PRED302pred00302
    • 2021-05-21
    118 min

    [HND-988]Lust Explodes After A 31-Day No-Sex Abstinence Challenge! Fresh Face Model With Big Beautiful G-Cup Tits Gets Her First Raw Creampie!! Kokona Asakura

  • asakura here censoredcreampiebig titsHNDhon nakatiger kosakaiHND-988HND988hnd00988
    • 2021-05-29
    141 min

    [MKON-053]My MILF Stepmom Is Young And Adorable, And Although I Could Never Tell Her To Her Face, I Like Her A Lot, And I've Always Hoped That She Would Never Get Remarried Hono Wakamiya

  • honoka wakamiya censoredcreampiebig titsMKONkaguyahimept mousouzokuichiro yumisakimikonMKON-053MKON053mkon00053
    • 2021-06-05
    131 min

    [STC-064][Confinement] Blonde Married Woman S&M 4: A Housewife With Colossal Tits Is Confined And Fucked Roughly With Aphrodisiacs

  • astrid star leila love censoredcreampieSTCspartan mousouzokuspartanSTC-064STC064stc00064
    • 2021-06-16
    145 min

    [PPPD-932]Fresh From Hokkaido - 19-Year-Old Northern Native! Cutie With Massive H-Cup Titties' Porn Debut! Rian Aoi

  • rian aoi censoredbig titssquirtingPPPDoppaiPPPD-932PPPD932pppd00932
    • 2021-07-15
    60 min

    Pacopacomama 071521_503 Unsatisfied Slutty Wife on Kimono Mari Onodera

  • amateur uncensoredpacopacomama
    • 2021-08-26
    195 min

    [NHDTB-567]Girls" Lesbian Pleasure Points Massage Parlor 2. Fondling And Nipple Play For An Innocent Body That Can Barely Take The Endless Orgasms

  • censoredlesbianNHDTBnatural highsakurai baniraNHDTB-567NHDTB5671nhdtb00567
    • 2021-09-03
    19 min

    FC2PPV 2106810 [Immediate Deletion Of Body Baldness] Depriving The Freedom Of Active K③ Of De M Who Got Acquainted With The Application, The Estrus Of Squirting Madness In The Height Of Youth

  • amateur uncensoredfc2
    • 2021-09-07
    129 min

    [KTRA-328]Beautiful Little Devil With A Shaved Pussy Shizuku"s Seductive Creampie Sex Vol.1 Step-Niece Edition Shizuku Asahi

  • shizuku asahi censoredcreampiebeautiful girlKTRAk tribeKTRA-328KTRA328
    • 2021-09-12
    50 min

    Pacopacomama 091221_111 Fuck with Sexy Anal Hair Braless Wife Kanae Murakami

  • amateur uncensoredpacopacomama
    • 2021-09-14
    66 min

    1Pondo 091421_111 Hospitality: Ladies Who Know How To Make Men Cum Sakura Kazuki Nana Kamiyama Rena Yui Kisaragi

  • amateur uncensored1pondo
    • 2021-09-17
    41 min

    FC2PPV 2211502 Appearance / First Shooting! !! Limited Number! [Uncensored] A Beauty Member With A Beautiful Sex Appeal And Passionate Sexual Intercourse … Although She Is A Beautiful Woman, She Is Too Nasty And Cums Twice! !! (Feature Film)

  • amateur uncensoredfc2
    • 2021-09-17
    94 min

    393OTIM-089 [Delusional Subjectivity] Fucking Nipple Blame Whispering Dirty Talk Temptation Dirty Little Gal Slut Natsuki Kisaragi

  • amateur censoredcreampieuniformotimotim-089otim089393otim-089
    • 2021-09-18
    55 min

    500DPL-0041 An Up-And-Coming Writer Makes A Vaginal Cum Shot AV Debut. Saya Akagi

  • amateur censoredcreampieamateurdpldpl-0041dpl0041500dpl-0041
    • 2021-10-07
    190 min

    [STARS-437]ローレン花恋 AV DEBUT

  • lauren hanako censoredsoloworkSTARSsod createkomatsu 17sod starSTARS-437STARS437
    • 2021-10-07
    51 min

    527SROC-016 Mari 2 (Mari Takasugi)

  • amateur censoredamateursrocsroc-016sroc016527sroc-016
    • 2021-10-08
    477 min

    [OFJE-332]Mei Washio Her First S1 Best Hits Collection 8 Hours A Super Charming Divine Titty J-Cup Beautiful Elder Sister Type All 14 Titles

  • mei washio censoredbig titssingle workOFJEs1 no 1 styleOFJE-332OFJE332ofje00332
    • 2021-10-09
    196 min

    [BAZE-005]Gal *Para 02

  • censoredcreampieschoolgirlBAZEk m producetetbazookaBAZE-005BAZE005baze00005
    • 2021-10-09
    139 min

    [URKK-045]The Perverted Landlord Next Door Rubs My Tits and Has Sex with Me Every Day, Hikari Sena

  • hikari sena censoredbig titssingle workURKKunfinishedrolandnyuukon no ichichichiURKK-045URKK045urkk00045
    • 2021-10-22
    195 min

    [HUNTB-122]An Exclusive Soapland That"s Been Passed Down Over Generations. Each Member Of The Family Helps Run The Soapland! Girls Work As A Bubble Princess, And Guys Work Behind The Scenes.

  • censoredblowjobHUNTBhunterkoichi davidsonhhh groupHUNTB-122HUNTB122huntb00122
    • 2021-10-28
    129 min

    [CHERD-077]"Not Keen on First Bare Back Being With an Older Lady？" Cherry Boy"s Perfect First Time Sex With Mature Married Woman. Miyu Tsubakihara

  • miyu tsubakihara censoredcreampiemarried womanCHERDcenter villageshibuyahanazono center villageCHERD-077CHERD077h-086cherd00077
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-03
    66 min

    FC2PPV 2400815 * Limited [Titty Fuck Pinching] The Long-Sought God Body Advent! Super Soft Milk Hcup Half Instagrammer Is Defeated And Fucking From The Appearance Ok! [First-Time Limited Privilege: Lotion Stool Fucking Pinch] [cen]

  • amateur uncensoredfc2
    • 2021-11-05
    150 min

    [URE-074]Ryou Ayumi Is Ripe For Picking! - Original Story: Minamoto - I Shouldn"t Have Deceived My Wive And Gone To That Event

  • ayumi ryo censoredcosplaymature womanUREmadonnakitorune kawaguchiure komiURE-074URE074ure00074
    • 2021-11-08
    72 min

    498DDH-043 I Will Allow Vaginal Cum Shot Without Permission! Flirting At Home With A Fluffy Healing Sister … "This Is No Good ♪" Raw Sex That Keeps Being Spoiled While Being Gently Scolded! From … Punishment Nipple Groping X Cowgirl

  • amateur censoredcreampieamateurddhddh-043ddh043498ddh-043
    • 2021-12-03
    148 min

    [JUFE-351]Pleasure of Piston As Speed Increases At Moment Condom Breaks And I Go In Raw! Sweaty Creampies With Chubby Unsatisfied Big Titted Married Woman Yuri Oshikawa

  • yuri sugawa censoredcreampiebig titsJUFEfitchJUFE-351JUFE351jufe00351
    • 2021-12-10
    162 min

    [RKI-620]I"d Like To Introduce You To A Pretty Slut. Enachi 22 Years Old

  • censoredcreampieblowjobRKIrookienao masakiRKI-620RKI620rki00620
    • 2021-12-21
    40 min

    FC2PPV 2534088 "How Many Cups Do You Have？" Miraculous Lori Huge Breasts Found In Front Of Hello Work, After Two Times In The Car, Stunned By The No-Hand Ejaculation That Holds The Chest Like Kyoho Fruit In The Car In The Daytime While Being

  • amateur uncensoredfc2



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download