so




FC2MARADASDSSISMIAASTARSHDKAGVHADNAWDIPXAVSADASDATIDCESDJUFENATRAUKGHMNEBODKBI

2020-04-24
316 min

[SCPX-391]Forbidden Sex With My Sweet Older Step-Sister: Giving Her A Raw Creampie So She Might Get Pregnant - 12 Girls, 5 Hours Special

  • censoredcreampiebig titsSCPXscoopno directormousouzokuSCPX-391SCPX391h-565scpx00391
    • 2020-04-24
    240 min

    [NANX-200]"This Is So Unlike Me!" - That's What This Married Woman Says, But The Way She Rides A Dildo Tells A Different Story - She Hesitates, But She Can't Resist A Good Hard Fucking! 2

  • censoredbig titsblowjobNANXnanpa heavenno directorNANX-200NANX200h-891nanx00200
    • 2020-04-23
    120 min

    [SW-699]Not Only Does She Have Big Tits, She Never Wears A Bra, So Her Titties Are Jiggling And Wiggling And I Can See Them And I Can't Take My Mind Off Of It, And She's Wearing Knee-High Socks And That Total Domain Of Eroticism Is So Allurin

  • censoredbig titsSWswitchswitch switchSW-699SW6991sw00699
    • 2020-04-21
    137 min

    [SDAM-046]Her Husband Had "Cuckold Fantasies" And So He Deceived His Wife And Left Her In A Coed Bath! She Was Wearing Sexy Swimsuits That Were More Shameful Than Being Naked, And She Came Over And Over Again Through Big Cock Piston-Pounding

  • censoredbig titshandjobSDAMsod createchain souSDAM-046SDAM0461sdam00046
    • 2020-04-21
    120 min

    [STARS-231]So Now You're Finally Ready To Fuck... She Knew Him Ever Since She Was A C***d, But One Day, Suddenly, She Got Fucked... Maria Wakui

  • maria wakui censoredschoolgirlsingle workSTARSsod createk westsod starSTARS-231STARS2311stars00231
    • 2020-04-19
    148 min

    [NNPJ-384]This Girl Was No Good At Talking And Couldn't Deal With Men, So She Decided To Star In AV To Get Over It. Watch Her Fuck And Swallow Ten Loads

  • censoredamateurblowjobNNPJnanpa japanNNPJ-384NNPJ384nnpj00384
    • 2020-04-19
    120 min

    [HND-826]My Girlfriend's Sister Loves Me So Much, She Wants Me To Get Her Pregnant - Akari Neo

  • akari neo censoredcreampieblowjobHNDhon nakausa pyonHND-826HND826hnd00826
    • 2020-04-19
    120 min

    [HND-828]I'm Sorry! It Feels So Good That I Can't Help But Cry Out She Doesn't Stop Rocking Back And Forth On Her G-Spot, And Cums In Cowgirl Creampie Action! Urara Kanon

  • hanaoto urara censoredcreampieblowjobHNDhon nakasapporo taroHND-828HND828hnd00828
    • 2020-04-17
    131 min

    [AOI-001]New Star Porn Debut! Sen Minano [Shock] Regular Girl Makes A Not So Regular Debut

  • 3rd generation marie marie censoredbdsmsingle workAOIprestigecharlie tanakatokyo blueAOI-001AOI001104aoi00001
    • 2020-04-17
    39 min

    [CLO-037]Embraced By A Titty Fuck - Her Tits Were So Gentle That It Felt Like I Was Being Hugged - Sayuki Kanno

  • kanno sayuki censoredbig titsblowjobCLOchobitchsuper bitchCLO-037CLO037h-1435clo00037
    • 2020-04-17
    121 min

    [RSE-033]Excuse Me Miss, We Heard That There Was A Pretty Hostess Here At This Inn, So We Seduced Her And Fucked Her And Filmed Voyeur Videos Of The Whole Thing 9

  • namiki touko satsuki yuri censoredmature womanRSErubychin takumarose rupyRSE-033RSE033rse00033
    • 2020-04-17
    112 min

    [TIKC-044][POV Log] When I Was Chilling With Aya Mitsuki Things Started To Get Steamy, So I Turned On The Camera And Started Filming!

  • aya mitsuki censoredbig titssingle workTIKCtikitiki.comerTIKC-044TIKC044tikc00044
    • 2020-04-16
    164 min

    [ROYD-005]"I'm Sorry...I Was So Lonely..." My C***dhood Crush Showed Up On My Doorstep Soaking Wet From The Rain Rei Kuruki

  • satoshi kuruki censoredschoolgirlbeautiful girlROYDroyalmorikihhh groupROYD-005ROYD005royd00005
    • 2020-04-16
    42 min

    FC2PPV 1334007 [No] Call The Boobs Meat Urinal Again And Make A Vaginal Cum Shot! I’ve Already Vaginal Cum Shot Many Times So Far, And This Meat Urinal Is The Last Inning. 【Selfie】

  • amateur uncensoredfc2
    • 2020-04-16
    161 min

    [ROYD-002]Cumming So Much That Even Her Slutty Friend Spasms And Convulses! Our Stepson Has A Monstrous Sex Drive! Eimi Fukada

  • emi fukada censoredbig titssingle workROYDroyalmorikihhh groupROYD-002ROYD002royd00002
    • 2020-04-15
    43 min

    FC2PPV 1336170 Nana-Chan, A Beautiful Busty College Girl Who Feels Too Much! The Third! It Feels So Good That I Promise To Meet Next Time! !!

  • amateur uncensoredfc2
    • 2020-04-13
    40 min

    [SHN-043]This Sensitive S*****t Gets So Turned On By A Train Pervert That She Can't Stop Her Body From Trembling And Getting Wet, Even As The People Around Her Start To Notice

  • censoredsquirtingschoolgirlSHNnatural highkansukespecially selected nachu girlsSHN-043SHN0431shn00043
    • 2020-04-13
    71 min

    FC2PPV 1334884 [Actually ㊙️ Former Av Actress] Discovered After Shooting Video In The Warehouse ❤️ Impressed By The Housewife After A Long Time ❤️ It Feels So Good That I Do Not Know How Many Times I Got It (Teru) * There Is A Review Privilege

  • amateur uncensoredfc2
    • 2020-04-12
    239 min

    [HONB-170]They Know I Shouldn't, But They Want To - Young Japanese Girls Are Having A Good Time, So They Let Themselves Get G*******ged

  • censoredcreampieHONBmercurythe first shibuya special f e headquarHONB-170HONB170h-1133honb00170
    • 2020-04-12
    153 min

    [USAG-010]"Everyone Tells Me That My Tongue Feels So Good That It Blows Their Minds..." This Gal Pretends To Be A Good Girl Who's Got A Split Tongue That She's Proud Of Showing Off! She Loves Adult Toys And Wants To Get Pumped Because

  • censoredbig titsblowjobUSAGrabbit daydreamersUSAG-010USAG010usag00010
    • 2020-04-11
    132 min

    [DASD-662]She Was Scheduled To Appear In An Idol Video, But Was So Hot That We Stuck Her In An AV. Akane (Fresh Face)

  • censoredslutDASDdasrokusaburo mishimaDASD-662DASD662dasd00662
    • 2020-04-11
    118 min

    [IPX-469]Convulsing So Hard She Pees Herself! Total Loss Of Control! New G-Spot Aphrodisiac Massage Salon: Evil Masseur Stuck His Dick In My Girlfriend. Momo Sakura

  • sakura sky momo censoredbig titssquirtingIPXidea pocketdishIPX-469IPX469ipx00469
    • 2020-04-11
    118 min

    [MIAA-258]I Finally Got My First Girlfriend, So I'm Going To Practice Sex And Creampies With My Female Friend First - Ichika Matsumoto

  • ichika matsumoto censoredcreampieschoolgirlMIAAmoodyzeveryone s porn starMIAA-258MIAA258miaa00258
    • 2020-04-10
    175 min

    [SABA-616]A Collector's Edition Offering A Perfect Record Of 9 Amateurs So Beautiful They'll Go Down In History! Watch Them Getting Off In Peerless, Piston Pumping Dildo Masturbation Action 2

  • censoredamateurSABAskyu shirotoSABA-616SABA616h-244saba00616
    • 2020-04-10
    35 min

    [BTH-026]If You Cum On My Face My Husband Will Find Out, So Try To Cum In My Mouth... Sumiro Kurokawa

  • sumire kurokawa censoredblowjobsingle workBTHchobitchsuper bitchBTH-026BTH026h-1435bth00026
    • 2020-04-09
    174 min

    [NHDTB-387]She Was Hooked On His Slobbering Kisses Filled With Drool So Thick It Stretched Like Cobwebs

  • censoreduniformschoolgirlNHDTBnatural highlemonheart nakajimaNHDTB-387NHDTB3871nhdtb00387
    • 2020-04-09
    201 min

    [DANDY-708]How Am I Supposed To Say No And Not Get Hard When This Foreign Tourist Is So Filthy？! An Ultra Slutty Blonde Girl Who Eats Japanese Dick Like Candy

  • censoredcosplaybukkakeDANDYdandymagical kikutasoDANDY-708DANDY7081dandy00708
    • 2020-04-07
    242 min

    [SDJS-061]Soft On Demand's All Nude 2020 Welcoming Ceremony: See The Pink Pussies Of Our 20 New Recruits A Very Embarrassing 4 Hour Special!

  • yuko murata noa utada censoredamateurSDJSsod createchain sousod female employeeSDJS-061SDJS0611sdjs00061
    • 2020-04-04
    183 min

    [GDHH-195]Her Pussy Was So Tight I Couldn't Help Myself And Fucked Her Raw! My Coworker Missed Her Train And Came Home With Me After A Work Party! Normally I Would...

  • censoredGDHHgolden timekiteretsuhhh groupGDHH-195GDHH195gdhh00195
    • 2020-04-04
    148 min

    [SSNI-750]Pissing/Squirting/Squirting Splashes She's Cumming So Hard She's Pissing Herself For The First Time Ever! A Massive, Flooding Orgasms Rin Kira

  • kira rin censoredsquirtingsingle workSSNIs1 no 1 stylemon cSSNI-750SSNI750ssni00750
    • 2020-04-04
    120 min

    [JUL-183]She Was Made To Cum So Hard She Wanted To Die, With A Man She Never Wanted To Fuck... Lana Kawai

  • kawai rana censoredmature womansingle workJULmadonnajo asagiriJUL-183JUL183jul00183
    • 2020-04-04
    240 min

    [HUNTA-753]My Sweaty, Horny Stepmom Is Demanding Creampie Sex So Hard That She's Mounting Me And Pressuring Me With Piston-Pounding Thrusts!! I Suddenly Got A New Stepmom, And She Was Super Sexy And Still Very Much A Woman!! And She Dressed So Er

  • censoredcreampieHUNTAhuntervolvo nakanohhh groupHUNTA-753HUNTA753hunta00753
    • 2020-04-04
    110 min

    [ATID-407]I Absolutely Hate Him, But He Made Me Cum So Hard, It Was Embarrassing... Iroha Natsume

  • natsume saiharu censoredsingle workdramaATIDattackersnaotoin madATID-407ATID407atid00407
    • 2020-04-03
    123 min

    [ONEZ-234]Her Body Is So Much More Sensitive After Giving Birth - Miracle Beautiful Big Breasts - The Most Beautiful Single Mother In The Neighborhood - Ai Takagi, 30yo

  • ai takagi censoredcreampiebig titsONEZprestigetodoonezONEZ-234ONEZ234118onez00234
    • 2020-04-01
    35 min

    FC2PPV 1320673 I Met A Cheap W Sober Child, But The Glue Was Good, So I Went Straight To The Hotel And Took A Gonzo With A Sailor Costume.

  • amateur uncensoredfc2
    • 2020-04-01
    117 min

    [DTSG-008]"The Oil Is... So Slippery" These Cute Estheticians Said It So Happily While They Glided On My Cock... Somehow I Had My First Fuck (Multiple Women) At My First Men's Massage

  • aika usagi ryo kitakata censoredsluthandjobDTSGoffice k sforever youngstay goldDTSG-008DTSG00836dtsg00008
    • 2020-03-28
    119 min

    [WANZ-947]There Was Nothing To Do On A Company Trip So I Tried Giving My Female Coworker Some Aphrodisiacs. It Turns Out She Is Actually A Total Slut With Amazing Tits And I Ending Up Pounding Her Raw And Filling Her With My Hot Load!! Sachiko

  • sachiko censoredcreampiebig titsWANZwanz factorywanzWANZ-947WANZ947wanz00947
    • 2020-03-27
    70 min

    428SUKE-010 The neat and clean beauty is incontinent with Joba Joba! !! It feels so good that it drools and makes me happy! !! Isn’t it the best way to see such a beautiful girl getting sloppy and sloppy？ !! I cling to the plump peach butt that

  • amateur censoredsquirtingamateursukesuke-010suke010428suke-010
    • 2020-03-27
    122 min

    [GIGL-589]"How Did An Old Lady Like Me Get You So Excited？" This Old Lady In Menopause Has Forgotten What It Feels Like To Be A Woman, But When She's Together With A Young Instructor(Whose Age Difference Is Big Enough To Make Them Steppar

  • censoredcreampiebig titsGIGLgigolo gigologigoloGIGL-589GIGL589h-860gigl00589
    • 2020-03-26
    172 min

    [NHDTB-385]A College Girl Takes Aphrodisiacs And Her Pussy Becomes So Tight It Could Pull Your Condom Right Off

  • censoredcreampiesquirtingNHDTBnatural highhopeless dainanaNHDTB-385NHDTB3851nhdtb00385
    • 2020-03-26
    56 min

    FC2PPV 1314585 49th Shooting Aya’s 19-Year-Old JD Imadoki Fashionable Slender Girl-If A Raw Cock Is Inserted, It Shows The Female Nature, So Cum Shot As It Is [Personal Shooting]

  • amateur uncensoredfc2
    • 2020-03-24
    140 min

    [SDAB-124]Breaking School Rules Feels So Good - My First Creampie At School... I Can't Help Thinking Something Might Go Wrong - Aoi Nakajou

  • nakagusuku censoredcreampieuniformSDABsod createbieber gonzoone s youthSDAB-124SDAB1241sdab00124
    • 2020-03-24
    139 min

    [STARS-217]Suzu Is So Outgoing And Full Of Herself... Someone Needs To Take Her Down A Peg Or Two... - Suzu Honjou

  • suzu honjo blue censoreddeepthroatSTARSsod createnao masakisod starSTARS-217STARS2171stars00217
    • 2020-03-22
    148 min

    [APGH-002]Tits So Good You'll Want To Suck Them Like A Lollipop! A Paradise of Endless Sex with Big-Titted Older Sister Tsugumi Morimoto

  • tsugumi morimoto censoredcreampiebig titsAPGHaurora project annexemu otoriaurora project anexAPGH-002APGH002apgh00002
    • 2020-03-21
    119 min

    [JUL-174]I Was So Lonely, That I Was Tempted, And I Knew It Was A Mistake, But I Was So Wet... - Pleasure So Intense It Will Make You Lose Your Mind, And Passionate, Illicit Sex - Maki Tomoda

  • maki tomoda censoredbig titsmature womanJULmadonnatakeshi kogaJUL-174JUL174jul00174
    • 2020-03-21
    149 min

    [CJOD-236]This Young Wife Hates Having Sex With Her Rich Husband, So She's Figured Out How To Make Him Cum Quickly To Get It Over With - AIKA

  • aika censoredcreampieblowjobCJODchijo heavensatsugu koyamaCJOD-236CJOD236cjod00236
    • 2020-03-21
    17 min

    FC2PPV 1309181 Even Though She Ejaculates With A Blow Job, Her Body Is So Good That Her Cock Recovers Quickly.

  • amateur uncensoredfc2
    • 2020-03-20
    44 min

    [MICA-026]Dark Gal Parties Until Morning And Is So Sensitive Her Entire Body Reacts Like A Clitoris

  • censoredblowjobMICAmicaelaMICA-026MICA026h-1346mica00026



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download