snis




FC2HZGDWANZSDABNATRSQTEHDKANACRHMNCHRVHNDGVHVEMAAPODMIDVSTARSMIAAFSDSSJULSPRDEBOD

2020-09-19
56 min

FC2PPV 1507031 [Individual shooting] Cuckolding her acquaintance’s J system, taking a squirrel, while worrying about her boyfriend, she leans back with another person’s cock and lusts with a big pant voice [Appearance / Creampie]

  • amateur uncensoredfc2
    • 2020-10-02
    58 min

    FC2PPV 1521134 * Limited idol face sophomore ♥♥ With big breasts, plenty of semen on the shame of Emiri-chan! !!

  • amateur uncensoredfc2
    • 2020-11-12
    132 min

    [MEKO-192]New 'Rent-A-MILF' Service 02 - These Housecleaners Are Known For Letting You Creampie Them, But We Try Asking For Something Even More Extreme

  • censoredcreampieamateurMEKOmilf laboMEKO-192MEKO192h-1160meko00192
    • 2020-11-13
    240 min

    [MBM-233]Carefully Selected Amateur Pick-up Documents! MAX Cute With Small Breasts! Lovely Girls With Small Tits, 14 People, 4 Hours

  • censoredcreampieamateurMBMprestigegaro sasazukambmMBM-233MBM233118mbm00233
    • 2020-12-12
    193 min

    [HJMO-447]Couples Challenge! If The Husband Cums Two Times To Eimi Fukada's Incredible Sex SK**ls, The Wife Will Take A Creampie From Some Other Guy!

  • emi fukada censoredcreampieslutHJMOhajime kikakuHJMO-447HJMO447hjmo00447
    • 2020-12-31
    194 min

    [PRED-278]Men's Massage Parlor Where A Pretty Older Sister-Type Girl With Milk Your Dick Dry Until You Lose Your Mind - Yuki Takeuchi

  • yuki takeuchi censoredcreampieslutPREDpremiumnao masakielegancePRED-278PRED278pred00278
    • 2020-12-31
    240 min

    [OFJE-292]Stunningly Beautiful Girls Try Their Best Techniques To Get Guys Off - Other Than Sex! Cocks Lovingly Lavished With Attention - Pleasure Like Never Before - 150 Loads

  • nanatsumori riri arisu aka censoredbig titsblowjobOFJEs one number one styles1 no 1 styleOFJE-292OFJE292ofje00292
    • 2021-01-01
    240 min

    [SOUD-022]泥●素人娘が大集合！リミッター解除でド淫乱ハイテンションSEX！！

  • censoredamateurSOUDprestigesaikyou chome chomeSOUD-022SOUD022118soud00022
    • 2021-01-17
    149 min

    [LZPL-056]Collosal Tits And Ass Lesbian Series Yuri Honma Yuria Yoshine

  • really yoshine yuria censoredbig titsLZPLlesreultimate ryolezure playLZPL-056LZPL056lzpl00056
    • 2021-01-19
    57 min

    107HISN-017 It looks like this and the number of experienced people exceeds 3 digits Former shot put player Ayaka Hirosaki (23) [Distribution exclusive] SOD rookie AV debut 165cm 61kg B: 92 (E) W: 78 H: 103 Ayaka Hirosaki

  • amateur censoredsquirtingamateurhisnhisn-017hisn017107hisn-017
    • 2021-01-19
    143 min

    [STARS-322]A College Girl Commits An Unexcused Absence And Gets Fucked For It Suzu Honjo She Had Brains And Beauty And Won The Grand Prize At A Beauty Pageant, But Now She Was Downgraded Into A Shitty Part-Time Job And Creampie Fucked And Her Life Is

  • suzu honjo censoredcreampiesingle workSTARSsod createeasy matsumotosod starSTARS-322STARS3221stars00322
    • 2021-01-29
    47 min

    FC2PPV 1630069 [LAST work] Overwhelming beautiful girl JD Yuka ❤️ Play with pink nipples and pretty body with naked sex ❤️ Natural thin hair Oma ○ Screw a hot meat stick into this ❤️ Luxury purchase privilege available

  • amateur uncensoredfc2
    • 2021-01-31
    36 min

    493PKPD-090 [Leak] Continuous convulsions Iki hell with big breasts and seeding copulation big cock

  • amateur censoredcreampiebig titspkpdpkpd-090pkpd090493pkpd-090
    • 2021-02-07
    144 min

    [TSF-013]You Used To Be An Otaku Boy, But When You Wake Up In The Morning, You Find That You Have Now Transformed Into A Woman (33) A Thorough Investigation This Man Used To Be An Otaku, But Now He's Been Reborn As A Beautiful Girl Who Looks Good

  • tetsuya sekine censoredcreampiebig titsTSFkaguyahimept mousouzokugynecomastia reportTSF-013TSF013tsf00013
    • 2021-02-18
    121 min

    [TOEN-038]As Soon As Her Husband Steps Out, This Slutty Stepmom Is Riding Her Stepson's Cock - 10 Creampie Loads A Day... Nanako Seto

  • nanako seto censoredcreampiemarried womanTOENcenter villageyoichi sanotaoyuanTOEN-038TOEN038h-086toen00038
    • 2021-02-18
    117 min

    [PPPD-903]Seduced By My Private Tutor - Wild Slut With Colossal Tits Only Raises My Erection, Not My Grades Hitomi

  • hitomi censoredcreampiebig titsPPPDoppaiPPPD-903PPPD903pppd00903
    • 2021-02-22
    141 min

    [GMEM-024]The Insane Shame Research Center Climax Dirty Queen Dirty Frenzy Hell A Lusty Horny Queen Withstands Insane Orgasmic Hell Toko Namiki

  • namiki touko censoredbdsmsingle workGMEMavs collector sbaba za babbyavscollector s goldGMEM-024GMEM024gmem00024
    • 2021-02-22
    39 min

    305TRUMG-135 Yuhato Yurie

  • amateur censoredmarried womanamateurtrumgtrumg-135trumg135305trumg-135
    • 2021-03-05
    37 min

    [BTH-124]If You Cum On My Face My Husband Will Find Out...Please Try To Get It In My Mouth Miku Aoki

  • misaki aoki censoredmarried womanbukkakeBTHchobitchchovicBTH-124BTH124h-1435bth00124
    • 2021-03-07
    64 min

    490FANE-33 Hana 2

  • amateur censoredbig titsamateurfanefane-33fane33490fane-33
    • 2021-03-15
    76 min

    FC2PPV 1711124 [G cup slime milk] I will expose private SEX with a big tits big butt gal w Blow with an erotic tongue with an open tongue is the best! Geki Yabahame shooting video that pierces from the top to the bottom and shakes the huge breasts

  • amateur uncensoredfc2
    • 2021-03-26
    118 min

    [CLUB-634]I Fell In Love With A Cheerful Slut And Seduced Her By Pretending I Was A Virgin. She Couldn't Help But Want To Break In A Sweet, Shy Boy Like Me And The Moment My Cock Met Her Big Tits She Fell In Love With My Erection. Part Two.

  • censoredbig titsuniformCLUBhentai shinshi clubCLUB-634CLUB634club00634
    • 2021-04-09
    201 min

    [IPX-634]FIRST IMPRESSION 148 Best In The Reiwa Era, Beautiful Y********l With Short Hair Who Doesn't Look Like A Porn Star Kotomi Ono

  • kotoyumi ono censoredblowjobbeautiful girlIPXidea pocketkyoseidishIPX-634IPX634ipx00634
    • 2021-04-13
    137 min

    1Pondo 041321_001 Mitsuha Kikukawa : Mitsuha Kikukawa Special Edition

  • amateur uncensored1pondo
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-01
    151 min

    [SSIS-057]Exquisite Female Office Worker Gets Fucked Over And Over By Middle Aged Men Who Have A Fetish For Panties And Stockings Tsubaki Sannomiya

  • sannomiya tsubaki censoredbeautiful girldeepthroatSSISs1 no 1 styleamazing meatSSIS-057SSIS057ssis00057
    • 2021-05-04
    67 min

    SIRO-4408 [First shot] [Fair-skinned active nurse] [Pushing into the back of the vagina ..] An inexperienced nurse teaches an adult. If you pierce with a big cock like playing with a delicate body .. AV application on the net → AV experience shooting

  • amateur censoredamateursirosiro-4408siro4408siro-4408
    • 2021-06-20
    240 min

    [SUPA-586]30-Barrage Irresponsible Creampies On A S-Class Beauty You Just Met!! BEST

  • censoredcreampiebig titsSUPAclass s amateurtaro kSUPA-586SUPA586supa00586
    • 2021-06-25
    145 min

    [MIDE-943]Fucking A Body Exploding With Sensitivity All Day Long Non-Stop Unlimited Orgasms Aphrodisiacs Squirting Ultimate Climax Shoko Takahashi

  • shoko takahashi censoredbig titssquirtingMIDEmoodyzdragon nishikawamoodyz divaMIDE-943MIDE943mide00943
    • 2021-07-09
    163 min

    [DASD-891]Sexy-Bodied Girl Always Smiling and Overflowing with Charm Makes Her AV Debut Yuri Omori

  • yuri omori censoredbig titsblowjobDASDdasinnabarDASD-891DASD891dasd00891
    • 2021-07-15
    129 min

    [KTKZ-088]The Large-Breasted Woman of Hakata. Kozue Aoki . (Pseudonym).

  • censoredbig titsamateurKTKZkitixx mousouzokushinjinKTKZ-088KTKZ088ktkz00088
    • 2021-07-20
    103 min

    FC2PPV 1899066 [Personal Shooting] Cool And Pretty Wet Beautiful Girl Seira-Chan Subjective / Objective Set

  • amateur uncensoredfc2
    • 2021-07-30
    145 min

    [SSIS-135]Drowning In And Teased With Relentless Cunnilingus and Sticky Kisses, The President"s Secretary Makes A Cuckold Of Her Husband. Marin Hinata

  • marin hinata censoredsingle workSSISs1 no 1 stylekyouseiSSIS-135SSIS135ssis00135
    • 2021-08-12
    125 min

    [FSDSS-267]Masochist Men Specialty Massage Parlor Where They Juice Your Cock Even After Cumming, Sora Amakawa

  • tenkawa sora censoredbig titshandjobFSDSSfalenozack araifaleno starFSDSS-267FSDSS2671fsdss00267
    • 2021-08-17
    26 min

    FC2PPV 2036103 [Completely New Work] High ◯ Dropout ★ Polite 18-Year-Old Gal With A Broken Rubber And Vaginal Cum Shot Play [Personal Shooting]

  • amateur uncensoredfc2
    • 2021-09-18
    66 min

    H4610 ki210919 Eri Tanba 22years Old

  • amateur uncensoredh4610
    • 2021-09-18
    148 min

    [MYBA-038]A Married Woman"s Blooming - Ai Hiraoka

  • ai hiraoka censoredmature womansingle workMYBAhitodzumaengokai emanuelkiiroi hyouMYBA-038MYBA038myba00038
    • 2021-09-23
    124 min

    [GS-404]She"s Pretending To Be A****p, Unguarded, And Luring You In, Because She"s A Sweaty Little Devil, Your Little Stepsister!! One Hot Summer Day, While Our Parents Were Away, I Noticed My Little Stepsister"s Panties Were Dripping Wet

  • censoredsisterGSsosoru garconreddo bo ruGS-404GS4041gs00404
    • 2021-09-25
    121 min

    [NSFS-029]New Atonement 5: A Wife Who Dedicated Her Body To Help Her Husband Iori Takahira

  • high ratio good cage censoredmature womansingle workNSFSnagae styletomitake taroNSFS-029NSFS029nsfs00029
    • 2021-09-29
    56 min

    491TKWA-194 J ● Raw Saddle Creampie & Cum Shot In The Saffle And Spear Room! (Airi Haruna)

  • amateur censoredcreampieschoolgirltkwatkwa-194tkwa194491tkwa-194
    • 2021-10-01
    238 min

    [BMW-243]Two-On-One Domination Pro Wrestling, VOL. 4. Saku Kurosaki

  • shinoda yu yui nagase censoredbig titsbeautiful girlBMWwanz factoryBMW-243BMW243bmw00243
    • 2021-10-02
    120 min

    [AUKG-522]Stepfamily Lesbians -Pure Cousin And Glasses Plain Daughter- Ami Kashiwagi, Tsukasa Nagano

  • ami kashiwagi tsukasa nagano censoredlesbiandramaAUKGu krentoAUKG-522AUKG522aukg00522
    • 2021-10-11
    65 min

    [SHH-026]Full Service Blushing Sluts This Creamy-Thighed Waitress Is Ready To Take Your Full Order

  • censoredbig titssquirtingSHHnatural highitaka smithlin powderSHH-026SHH0261shh00026
    • 2021-11-11
    55 min

    413INST-182 [Married Woman 5P Orgy Individual Shooting 3] Oil Puru Puru W Big Breasts I Cup Two Married Women Young Penis A Bikini Wife Who Goes Crazy For Deliciously

  • amateur censoredcreampiebig titsinstinst-182inst182413inst-182
    • 2021-11-12
    54 min

    230OREC-938 Morishita (Mariko Morishita)

  • amateur censoredcreampieamateurorecorec-938orec938230orec-938
    • 2021-11-12
    123 min

    [PRED-354]I Only Wanted To "Fuck Her Once"...But I Can"t Stop My Adulterous Ejaculation From The Sticky Intercourse With This Plain Office Girl...Mami Sakurai

  • mami sakurai censoredblowjobslutPREDpremiumdoragon nishikawaelegancePRED-354PRED354pred00354
    • 2021-11-12
    123 min

    [BOBB-325]We"re Bringing Out The Absolute Best Of Her Alluring, Divine J-Cup Colossal Tits! Super Selections! 6 Situations Boin "Misono Mizuhara" Box 2 If You"re Into Fetishes, Check Out (Our Proudest Accomplishments) Videos

  • suwon miso censoredbig titscosplayBOBBabc mousou zokuboinbb abc mousou zokuBOBB-325BOBB325bobb00325
    • 2021-11-13
    100 min

    [SUJI-146]Small Shaved Pussy Creampie~ Fetish Pervert"s Filthy Obscenities~ Rara Kudo 142cm

  • lara kudo censoredcreampiebeautiful girlSUJIkan ran monoSUJI-146SUJI146suji00146



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download