shame digital mosaic censored jav def




FC2JUFEIPXCESDKSBJSTARSONEZSDABHODVSQTEMILKATIDMARASSNIAWDMIAASHKDAUKGMEYDVEMASAN

2020-12-01
272 min

[C-2593]Full Edition: The Married Woman Sayako Series Secret Travel Encounters Of A Wife, Mother, And More...

  • censoredmarried womanCgo goesgogo s coreC-2593C2593140c02593
    • 2020-12-06
    158 min

    [SORA-285]This Maso And Lusty And Aggressive Lolita Little Bitch Is Prepared To Be Shamed And Volunteering For Breaking In Training! (She Wants To Expose Her Pig-Faced Shame) (Deep Reverse Irrumatio) (Big Dick Threesome G*******ging Sex) (Shameful Go

  • chiharu miyazawa censoreddeepthroatsingle workSORAyama to sorausubashisuiSORA-285SORA285sora00285
    • 2020-12-06
    240 min

    [MMB-338]There's Nothing Better Than The Thrill Of Sex In The Afternoon - 10 Horny Housewives Who Love Creampie Sex And Keep On Fucking Even When Visitors Cum Calling -

  • aki sasaki kina shinozaki censoredcreampiemature womanMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-338MMB338mmb00338
    • 2020-12-12
    166 min

    [IPX-582]Nipples So Sensitive They're A Must-See! Adorable Idol At A Nipple Massage Parlor Kana Momonogi

  • kana momonogi censoredbeautiful girlslutIPXidea pocketdishIPX-582IPX582ipx00582
    • 2020-12-26
    267 min

    [HZMEN-006]My Female Coworker Let Her Guard Down With Her Pantyhose And My Dick Got Hard! I Couldn't Help But Start Rubbing It On Her Pantyhose SP

  • rio okita ashamed censoredHZMENz menHZMEN-006HZMEN006h-1371hzmen00006
    • 2021-01-15
    152 min

    [MDTM-699]A Barely Legal Girl For Me Alone, Who Will Let Me Creampie In Her Anytime! Ruka Inaba

  • inaba censoredcreampiebig titsMDTMuchu kikakusuginokiMDTM-699MDTM699h-585mdtm00699
    • 2021-01-17
    131 min

    [NYL-001]Tied Up Mother: She Becomes Prey Because Of Her Son... Mari Kuroki, 43 Years Old

  • kuroki mari censoredbig titsmature womanNYLnile daydream tribeichikan abashiriNYL-001NYL001nyl00001
    • 2021-01-24
    125 min

    [TWYB-002]The Forbidden Secret Part-time Job Of Local Teachers - Natsuno Ayamine

  • natsuno ayamine censoredcreampiebig titsTWYBtoyohikotoyohikotoyohiko kikakuTWYB-002TWYB002twyb00002
    • 2021-01-29
    51 min

    [fan-101]れい

  • amateur censoredbig titsamateurfanfan-101fan101fan-101
    • 2021-02-19
    103 min

    [VENX-009]My Bride's Mother Is Filling Out As A Banging MILF And It's Getting Me Hard Chitose Yuki

  • chitose in the evening censoredcreampiebig titsVENXvenusmajime kitanofakecest winntersVENX-009VENX009venx00009
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-22
    133 min

    [SRMC-029]It Can't Be True That You Can Make Sex Feel 100 Times Better Just Through The Power Of Suggestion! 2 Mizuki Yayoi

  • mizuki yayoi censoredsquirtingbeautiful girlSRMChypnosisrusher miyoshiSRMC-029SRMC029srmc00029
    • 2021-03-06
    62 min

    H4610 ki210306 Gold Pack 20years old

  • amateur uncensoredh4610
    • 2021-03-11
    35 min

    [GRMR-037]嫉妬彼氏の束縛エッチ ～優しい彼のドSなお仕置き～

  • ako momona kou akemi mari koizumi hiroomi nagase censoredGRMRmura chleo hakusanGRMR-037GRMR037h-1534grmr00037
    • 2021-03-22
    69 min

    241GAREA-499 Akane

  • amateur censoredamateurgareagarea-499garea499241garea-499
    • 2021-03-28
    125 min

    [JKW-020]巨乳中出し 森脇江里奈

  • erina moriwaki censoredcreampiebig titsJKWjeweljueruJKW-020JKW020h-848jkw00020
    • 2021-04-08
    61 min

    [413INST-111]【爆乳OL・乱交個撮】個撮職人大集合！Kcupミラクル爆乳OL

  • amateur censoredcreampiebig titsinstinst-111inst111413inst-111
    • 2021-04-18
    113 min

    [XRW-996]Breaking In A Naughty Young Wife - I'll Lend You My Bride - Suzu Monami

  • monami bell censoredcreampiedeepthroatXRWreal worksreal real worksXRW-996XRW996xrw00996
    • 2021-04-20
    88 min

    [DOKI-012]Watching An Art S*****t Jerking Off During A Drawing Class!

  • censoredamateurblowjobDOKIstar paradisedokiDOKI-012DOKI012h-254doki00012
    • 2021-04-30
    45 min

    H4610 ki210502 Rei Tanaka 19years old

  • amateur uncensoredh4610
    • 2021-05-14
    152 min

    [ROYD-053]My Boss Was Tired, So I Had To Take Him Home ... And Then I Found Myself 1cm Away From Some Amazing Areolas!？ My Boss' Daughter Was Standing There In Her Roomwear, And I Got A Rock Hard Erection! She Lured Me To Temptation With Some Bra

  • saya matsui censoredcreampieschoolgirlROYDroyalkawajirihhh groupROYD-053ROYD053royd00053
    • 2021-05-22
    131 min

    [KSAT-038]POV Documentary! Crazy Body Fluid Aphrodisiac Sex With Big Titty Wife Honoka 26 Years Old

  • censoredcreampiebig titsKSATstrong woman s table daydream tribesix mantable of a strong womanKSAT-038KSAT038ksat00038
    • 2021-05-28
    99 min

    [YST-244]Tanaka-san Is My Neighbor And For Some Reason She Keeps Cumming To My House And Playing With My Nipples The Entire Time (Sweating) Nene Tanaka

  • nene tanaka censoredcreampiebig titsYSTkomyoYST-244YST244540yst00244
    • 2021-05-29
    35 min

    FC2PPV 1841563 [Business trip orgy] Local advertising agency Event planning department OL 2 people x Chararyman 3 people ② [High image quality]

  • amateur uncensoredfc2
    • 2021-06-04
    111 min

    [FTHT-015](Her G-Spot's Possessed! Orgasms Right Down To Her Womb!) The Ultimate Ecstasy! Peerless Cock Addicts Fuck Their Own Faces With Cock And Willingly Give Guys Rimjobs! Nipple Teasing And Pussy Destruction! "Let's Cum Together! Ple

  • censoredcreampieFTHTfalenodavielfalenotubeFTHT-015FTHT0151ftht00015
    • 2021-06-04
    138 min

    [JUL-606]Only For Me! Married Creampie Maid Has To Do Whatever She's Told Total Obedience To Her Step Uncle's Orders Days Spent Being Trained And Fucked Hijiri Maihara

  • kiyoshi maihara censoredcreampiemature womanJULmadonnarokusaburo mishimaJUL-606JUL606jul00606
    • 2021-06-19
    140 min

    [JUL-624]The Endless Days Of Creampie Fuck. Marika Kobayashi

  • marika kobayashi censoredcreampiebig titsJULmadonnaunicorn fukudaJUL-624JUL624jul00624
    • 2021-07-06
    72 min

    200GANA-2513 Seriously Nampa, first shot. 1659 Bring the young wife who picked up the dropped wad to the hotel! What if I poke a gap in my frustrated heart with my husband …？ Shaking milk! Rippling ass! Nailed to a plump body!

  • amateur censoredbig titsmarried womanganagana-2513gana2513200gana-2513
    • 2021-07-23
    124 min

    [BIJN-204]THE Document, Natural Hard Cumming, Divorcee has Remarried but She's still the Kind of Slutty Housewife who Loves Cock so much She Can't Resist an Orgy. Miho Tono

  • miho tsuno censoredcreampiesingle workBIJNbijin majoBIJN-204BIJN204bijn00204
    • 2021-07-23
    127 min

    [JJCC-005]The Wife's Overflowing Nectar Yuna

  • censoredcreampiemature womanJJCCjukujo japanJJCC-005JJCC005jjcc00005
    • 2021-07-30
    119 min

    [JBD-272]Unbanned For The First Time: The Bondage Of Shame Enema Riho Fujimori

  • riho fujimori censoredbdsmsingle workJBDattackerskanou hanahebi bakuJBD-272JBD272jbd00272
    • 2021-08-09
    80 min

    FC2PPV 1975743 Bristle Slender Kotoha Is 18 Years Old. The Bristle Man Hair Is Innocent In The Outstanding Style Of The Slender Body. Although She Is Ashamed Of The Pleasure Of An Adult Cock, Her Pant Voice Does Not Stop And A Large Amount Of Vaginal

  • amateur uncensoredfc2
    • 2021-08-26
    122 min

    [FSDSS-273]Girl Who Fucks Too Much Gives Blowjob To Housemates Rin Natsuki

  • rin natsuki censoredbig titsblowjobFSDSSfalenomaeda satoshifaleno starFSDSS-273FSDSS2731fsdss00273
    • 2021-09-12
    57 min

    HEYZO 2608 Tall MILF Got Fucked – Noriko Totsuka

  • noriko totsuka uncensoredcreampieheyzo
    • 2021-09-29
    89 min

    348NTR-035 <Creampie To Fiance! > Discover A Sexy Sister In Front Of A Naughty Shop! !! The Man Who Feels The Difference In Age Next To Him Is Said To Have Been Engaged With His Boyfriend. He Puts Her On AV "Because I Don’t Work Very Wel

  • amateur censoredcreampiebig titsntrntr-035ntr035348ntr-035
    • 2021-10-01
    238 min

    [BMW-243]Two-On-One Domination Pro Wrestling, VOL. 4. Saku Kurosaki

  • shinoda yu yui nagase censoredbig titsbeautiful girlBMWwanz factoryBMW-243BMW243bmw00243
    • 2021-10-07
    124 min

    [FSDSS-304]While Working At The Same Convenience Store As Her Boyfriend, She Gets Entangled With A Terrible Older Guy For Passionate Sex And Orgasms That Extend Late Into The Night. Arina Hashimoto

  • there is hashimoto censoredbeautiful girldramaFSDSSfalenomaeda ichimonfaleno starFSDSS-304FSDSS3041fsdss00304
    • 2021-10-17
    50 min

    FC2PPV 2352538 October Limited 1480 [Nothing] Slender And Beautiful Gal Wife Who Lives In The Housing Complex. She Was Late For Repayment And She Took Her To A Public Toilet And Forcibly Took A Continuous Vaginal Cum Shot.

  • amateur uncensoredfc2
    • 2021-10-30
    60 min

    318LADY-388 Mitsuki (Nagisa Mitsuki)

  • amateur censoredcreampieamateurladylady-388lady388318lady-388
    • 2021-11-05
    184 min

    [HUNTB-139]A Dream Threesome! Step-sister Went Out Partying With Her Female Friend And Missed The Last Train Home, Now They"re At My Apartment Laying In Bed With Me! The Toss And Turn In Bed, Revealing Their Panties And Breasts...

  • censoredcreampieblowjobHUNTBhunterkoichi davidsonhhh groupHUNTB-139HUNTB139huntb00139
    • 2021-11-13
    122 min

    [ZOCM-011]Spend All Night Making Babies With Adulterous Creampie Sex In Love Hotel Shared With Plain S*****t. Beautiful Fair-Skinned Girl Mai-Chan. Mai Kagari

  • flower hunting censoredcreampieuniformZOCMzokuzoku musume mousouzokutodozokuzoku musumeZOCM-011ZOCM011zocm00011
    • 2021-12-13
    54 min

    544IDJS-080 Anju (25) [Female Anna Style Beauty] [Super Beautiful Legs] [Creampie]

  • amateur censoredcreampieamateuridjsidjs-080idjs080544idjs-080
    • 2022-01-04
    19 min

    10musume 010422_01 Secret Pussy Collection: Akari Kato

  • amateur uncensored10musume
    • 2022-01-08
    149 min

    [SCOP-752]Having A Few With Your Coworker Until She Drifts Off... Excited By Her Defenseless Body... But When Her Eyes Open Again She"s Horny Too And Raring To Cum!

  • censoredbig titsSCOPscoopmaso knifemousouzokuSCOP-752SCOP752scop00752
    • 2022-01-14
    56 min

    [ETQR-341][Daydream POV] Total Obedience, Ovulation Day, Slut Maid, And Sex To Have C***dren. Suzume Sho.

  • sho suzume censoredcreampieblowjobETQRerotic timeETQR-341ETQR341etqr00341
    • 2022-01-21
    141 min

    [DASD-961]Popular Sluts At School Fall In Love With My Unpopular Dick Yuri Fukuda Rika Tsubaki

  • yuri fukada tsubaki rika censoredbig titsuniformDASDdasrokusaburo mishimaDASD-961DASD961dasd00961
    • 2022-01-29
    480 min

    [RVG-154]A Big Tits Widow Gets G*******g Fucked By Dirty Old Men And Turned Into Their Sex S***e Best Hits Collection vol. 2

  • rena fukiishi kimishima mio censoredbig titsRVGglory questRVG-154RVG154rvg00154
    • 2022-01-31
    66 min

    WKAS-009 Mina (Mina Kitano)

  • amateur censoredbig titsamateurwkaswkas-009wkas009wkas-009



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download