school uniform censored devil javcensored schoolgirl




FC2AVSAADNGMEMMIDVSQTEWAAAMIAAPPPDNATRCHRVAUKSGVHPREDHNDBLKMILKAUKGAWDLULUEBOD

2020-10-26
150 min

[IBW-798]「お父さん、お願い…もうヤメて…」父親に幾度も犯●れ続ける娘の近親相姦映像

  • amateur censoredIBWi b worksIBW-798IBW798
    • 2020-10-27
    85 min

    [NUBI-044]Felt Up On A Crowded Train - Meek College Girl Made Pliable With Some Masterful Fondling

  • censoredcreampieNUBIkalimantannubiaNUBI-044NUBI044h-1112nubi00044
    • 2020-11-09
    64 min

    SIRO-4316 [First shot] [Superb slender nude] [Underwear shop clerk’s lingerie] Slender beauty with tight eyes. When the switch is turned on to her who is embarrassed .. AV application on the net → AV experience shooting 1388

  • amateur censoredamateursirosiro-4316siro4316siro-4316
    • 2020-11-10
    140 min

    [KMHRS-032]Almost 100,000 Followers On TikTok! The AV Debut Of Cute And Erotic Gal That Everybody Is Talking About Now - Sora Kanamu

  • kano yume sora censoredamateursingle workKMHRSsod createkaorukimihoreKMHRS-032KMHRS0321kmhrs00032
    • 2020-11-13
    120 min

    [MEYD-633]Headed Home To Cheat - Married Woman Goes Back To Her Hometown To Give Birth And Ends Up Taking Her Ex-Boyfriend's Creampie. Ai Sayama

  • sayama love censoredcreampiebig titsMEYDtameike gorosugawaraMEYD-633MEYD633meyd00633
    • 2020-11-19
    240 min

    [HUNTA-895]My Sub Girlfriend Awakened My Inner Dom! The Number Of Years I've Been Alive Equal s The Number Of Years I've Been Single So Far, And My Sexy, Cute Girlfriend's Never Had A Boyfriend Before Either!

  • censoredcreampiedeepthroatHUNTAhuntergeminihhh groupHUNTA-895HUNTA895hunta00895
    • 2020-11-26
    76 min

    432YKMC-041 Yume

  • amateur censoredcreampiebig titsykmcykmc-041ykmc041ykmc-041
    • 2020-12-04
    122 min

    [UMD-759]Lucky Glances At Exposed Cleavage - It Looked Like She Wasn't Looking, But She Totally Saw You？! 15 - Yoga Instructor Edition -

  • hasumi claire ai mukai censoredUMDleodragon nishikawaUMD-759UMD759125umd00759
    • 2020-12-06
    158 min

    [SORA-285]This Maso And Lusty And Aggressive Lolita Little Bitch Is Prepared To Be Shamed And Volunteering For Breaking In Training! (She Wants To Expose Her Pig-Faced Shame) (Deep Reverse Irrumatio) (Big Dick Threesome G*******ging Sex) (Shameful Go

  • chiharu miyazawa censoreddeepthroatsingle workSORAyama to sorausubashisuiSORA-285SORA285sora00285
    • 2020-12-29
    59 min

    Pacopacomama 122920_406 Rinka Mizuhara

  • rinka mizuhara uncensoredcreampieblowjobpacopacomama
    • 2020-12-31
    200 min

    [HUNTA-918]The Most Popular Booth At This Private Girls' High School Festival, "The Quickie," Offers Refreshments To A Long Line Of Customers. Just What Could Be Inside？!

  • censoredcreampieschoolgirlHUNTAhuntermasanorihhh groupHUNTA-918HUNTA918hunta00918
    • 2021-01-08
    119 min

    [FSDSS-156]The Gravure Idol's First Experiences 3 - Sara Kamiki

  • sara kamiki censoredbig titsbeautiful girlFSDSSfalenosatoshi maedafaleno starFSDSS-156FSDSS1561fsdss00156
    • 2021-01-15
    31 min

    FC2PPV 1641711 [No x Suppin] Now, the continuation of “sex” … The vivid reaction is the best! [Second half of overtime]

  • amateur uncensoredfc2
    • 2021-01-23
    156 min

    [JUKF-054]Only Busty Girls - Stepsister For Rent Rika-Chan Rika Tsubaki

  • tsubaki rika censoredcreampiebig titsJUKFjumpjump avJUKF-054JUKF054h-227jukf00054
    • 2021-02-17
    79 min

    259LUXU-1385 Luxury TV 1367 A beautiful beautician who feels rewarding for her dream job, but is chased by busy days and suffers from unfulfilled desires away from the warmth of men! While nervous about the big cock she sees for the first time in a l

  • amateur censoredamateurlingerieluxuluxu-1385luxu1385259luxu-1385
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-22
    133 min

    [OPPW-087]She Tried Meeting Men Online And Went To Meet Them Ready To Fuck, But They All Turned Out To Be Perverts With Abnormal Fetishes, So, Feeling Unsatisfied, She Decided To Make Her Debut As An AV Porn Actress To Get Her Fill Of Sex! Kanade Asa

  • asahina kanade censoredsingle workOPPWopenipeni world mousouzokuumanosukeOPPW-087OPPW087oppw00087
    • 2021-03-09
    39 min

    [ore-762]サリナ 2

  • amateur censoredcreampieamateuroreore-762ore762ore-762
    • 2021-03-11
    119 min

    [FSDSS-185]All Night Sex After Getting Caught In The Rain With My Female Coworker Nene Yoshitaka

  • nine yoshitaka censoredblowjobsingle workFSDSSfalenodragon nishikawafaleno starFSDSS-185FSDSS1851fsdss00185
    • 2021-03-24
    52 min

    444KING-030 Nanami (21)

  • amateur censoredcreampiebig titskingking-030king030444king-030
    • 2021-04-16
    110 min

    [HZGD-184]Innocent Celebrity Busty Housewife Fell In Love While Getting Fucked! Mia Hasaki

  • mia hasaki censoredcreampiebig titsHZGDmarried woman flower garden theaterhanukemaru kinpikaimage married woman flower garden theatHZGD-184HZGD184h-1100hzgd00184
    • 2021-04-20
    240 min

    [ARM-974]Raunchy Asses Shake And Buck As They Sexily Riding Dick Cowboy Style

  • abe mikako ai mukai censoredblowjobARMaroma planningaromaARM-974ARM974arm00974
    • 2021-04-22
    124 min

    [FSDSS-207]Getting Up Close And Personal With Views Of A Huge Ass! Minori Kawana

  • real village henan censoredbeautiful girlsingle workFSDSSfalenotake dfaleno starFSDSS-207FSDSS2071fsdss00207
    • 2021-05-02
    151 min

    [FCDC-132]Secretary With A Huge Round Ass Turns Out To Be A Slutty Nympho Who Seduces The Office Workers With Her Erect Nipples Kurumi Tamaki

  • tamaki walnut censoredslutsingle workFCDCweekenderFCDC-132FCDC132fcdc00132
    • 2021-06-01
    40 min

    475SKCK-033 Himena 1

  • amateur censoredanalamateurskckskck-033skck033475skck-033
    • 2021-06-15
    128 min

    [KTRA-302]Horny Stepsister Wants Her Stepbrother - Creampie Temptation Urara Kanon

  • hanaoto urara censoredcreampieschoolgirlKTRAk tribeKTRA-302KTRA302h-094ktra00302
    • 2021-06-19
    120 min

    [MISM-205]Obedient Maid Deep Throats Dick Rena Asami

  • asami rena censoredbdsmMISMemumusume labinabarMISM-205MISM205mism00205
    • 2021-07-09
    180 min

    [MIDE-951]Massage Parlor that Allows Multiple Ejaculations and Additional Semen and Will Make You Cum Even if You Say "I Said I'm Already Cumming" Nozomi Ishihara

  • ishihara hope censoredsluthandjobMIDEmoodyzkyoseimoodyz divaMIDE-951MIDE951mide00951
    • 2021-07-13
    64 min

    HEYZO 2570 Soapland Whore Gets Cream Pie On First Day of Work! – Akari Soma

  • akari soma uncensoredcreampieheyzo
    • 2021-08-03
    136 min

    [SDMM-094]Magic Mirror Bus, College Girls Going To Tokyo Only! Intense Vibrating Climax Chair Switch ON While On Video Call With Boyfriend! She Wins A Prize If She Finishes The Call Without Being Found Out! But... Her Clit Is So Stimulated That Her N

  • amaha noi censoredsquirtingamateurSDMMsod createdainanamirror noSDMM-094SDMM094
    • 2021-08-16
    31 min

    FC2PPV 2031941 First Shot! !! Limited Number! [Uncensored] Cheating For The First Time Without Telling Your Boyfriend! Creampie To A Beautiful Woman Who Met At A Town Con! !! (Blow Scene Appearance)

  • amateur uncensoredfc2
    • 2021-08-21
    124 min

    [ENKI-040]In Her 20s But Slept With At Least 1000 Guys Meeting An Easygoing Legendary Slutty Bitch From The Red Light District At An Event Cool And Shameless, We Have A Nonstop Fucking After Some Foreplay! But The Tables Turn When I Creampie Her Over

  • censoredcreampiedeepthroatENKIk m producedoku enkaiENKI-040ENKI040enki00040
    • 2021-09-25
    119 min

    [CEMD-062]Lewd Anal Masturbator! Kayo Iwasawa -She Practically Loses Herself For Non-stop Anal Masturbation.

  • kayo iwasawa censoredanalbig titsCEMDserebu no tomoCEMD-062CEMD062cemd00062
    • 2021-10-02
    101 min

    [SQTE-384]Creampie Sex With H-cup Otaku Madoka - Madoka Shizuki

  • madoka shizuki censoredcreampiebig titsSQTEs cutes cute s cuteSQTE-384SQTE384sqte00384
    • 2021-10-07
    126 min

    [IENF-169]Guy Starts Messing with His S******g Sister and Is Shocked When She Asks to Fuck Him Raw. He Tries to Pull Out When He"s About to Cum, But She Wraps Her Legs Around Him and Makes Him Cum in Her! 3

  • hanamiya amu sakura tsuji censoredcreampieslutIENFie nergyienfIENF-169IENF1691ienf00169
    • 2021-10-22
    150 min

    [HMN-063]My Girlfriend"s Little Sister Loved Me So Much That I Had To Knock Her Up On The Side Aoi Amano

  • ao amano censoredcreampiebig titsHMNhonnakausapyonHMN-063HMN063hmn00063
    • 2021-10-30
    151 min

    [KTB-054]Wife Next-door Wears Tight Suits And Is Actually A Horny Semen Junkie That Gets Sexual Harassment And BUKKAKE At The Office Each Day! Office Lady Club 10. Monami Takarada

  • takarada monami censoredcreampiebig titsKTBkahanshin tigers mousozokukahanshin tigersKTB-054KTB054ktb00054
    • 2021-11-05
    52 min

    ORE-797 Ruka 2 (Ruka Inaba)

  • amateur censoredcreampiebig titsoreore-797ore797ore-797
    • 2021-11-06
    71 min

    422ION-109 Iori (Momoka Kato)

  • amateur censoredamateurblowjobionion-109ion109ion-109
    • 2021-11-13
    60 min

    519MAZOF-024 [Sexual Spring, Let Me Suck Up To Boobs] Municipal School Health Teacher 26 Years Old [Shaved] Delusional Masturbation With Students As Side Dishes, On Holidays, Saffle College Student And Dating Man Violently Fucked And Faint In Agony A

  • amateur censoredcreampiebig titsmazofmazof-024mazof024519mazof-024
    • 2021-11-16
    59 min

    SIRO-4669 [First Shot] [Elegant Appearance] [Sigh That Leaks Indecently] Politeness ○ A Beautiful Tutor Who Has Both Wisdom And Bewitching Advent. The Intense Piston From Her Back Writhes Her Outstanding Style, And While She Has An Ecstatic Expressio

  • amateur censoredamateursirosiro-4669siro4669siro-4669
    • 2021-11-21
    82 min

    345SIMM-678 [101cm J Cup! Kansai Dialect Beauty Huge Breasts J ○! ] Even Though It’s Huge Breasts, It Doesn’t Hang Down At All! Uncle And Icharab Sex While Shaking The Non-Standard Beautiful Huge Breasts Against Gravity With Balun Balun ♪!

  • amateur censoredcreampiebig titssimmsimm-678simm678345simm-678
    • 2021-12-04
    122 min

    [MKON-068]Girlfriend Is A S*****t Shogi Player That Was Prideful And Never Wanted To Lose A Shogi Match To Anyone, But Now She"s A Slut That Needs Sex And A Creampie Load From A Middle Aged Dick. Kanade Kanon

  • kanon kanon censoredcreampieuniformMKONkaguya hime pt mousozokuyumesaki ichiroumikonMKON-068MKON068mkon00068
    • 2021-12-10
    178 min

    [HUNTB-153]For A Set Price, You Can Fuck Anyone You Want, As Much As You Want! As Long As You Pay The Monthly Fee, You Can Fuck Anyone In This Apartment Building, Whether It"s A College Girl, A Married Woman, Or An Office Lady!

  • censoredcreampieHUNTBhunterkorosukehhh groupHUNTB-153HUNTB153huntb00153
    • 2021-12-10
    62 min

    FC2PPV 2313436 [Personal Shooting] Misa 29 Years Old, Letting A Beautiful Woman Lick The Whole Body And Cum Inside A Big Dick! !!

  • amateur uncensoredfc2
    • 2021-12-11
    151 min

    [SCOP-749]The Horny Young Wife From Next Door Is Wearing A Tight Mini One Piece Dress And Using My Cherry Boy Cock Like Her Own Personal Dildo And Cumming Her Brains Out

  • censoredcreampiebig titsSCOPscoopk taromousouzokuSCOP-749SCOP749scop00749
    • 2021-12-17
    78 min

    259LUXU-1515 Luxury TV 1497 A Neat And Clean Beauty With A Fresh Feeling Is Here! It’S Been 2 Years Since I Had Sex! ？？ If You Play With Your Frustrated Body For The First Time In A Long Time And Insert A Big Cock Into A Thickened Maco, You Will

  • amateur censoredamateurluxuluxu-1515luxu1515259luxu-1515
    • 2021-12-24
    115 min

    [OAE-213]Rainbow-Colored Platonic. Iroha Shirasaki

  • iroha shirasaki censoredsingle workOAEaircontrolsunsetleeOAE-213OAE213oae00213



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download