sapporo taro




FC2ONEZCESDSTARSMEYDSSNICAWDFSDSSDTTNNPJJULAUKGNATRGMEMHNDNGODSHKDVENXNACRHMNCHRV

2020-12-20
111 min

[OAE-204]ALL NUDE - Riri Nanatsumori

  • nanatsumori riri censoredsingle workOAEaircontrolzaku araiOAE-204OAE204oae00204
    • 2020-12-25
    45 min

    [DHT-236]CAR SEX DRIVE - Yurie Yamano, 43 Years Old

  • censoredamateurmature womanDHThot entertainmentshungoDHT-236DHT23659dht00236
    • 2021-01-15
    114 min

    [SUPA-560]いやらしいお姉さんの濃密フェラチオと背面手コキ vol.2

  • censoredamateurblowjobSUPAs kyuu shiroutoSUPA-560SUPA560h-244supa00560
    • 2021-01-23
    59 min

    FC2PPV 1656538 ☆ Limited number, final discount! ☆ The coming-of-age ceremony has been canceled and all schedules are awesome! Misa is a beautiful girl who earns pocket money by having sex with her hungry man. Creampie! Cleaning cum! [Multiple benefi

  • amateur uncensoredfc2
    • 2021-02-05
    163 min

    [HEZ-253]Is It True That Young People Aren't Having Sex Anymore!？ We Asked Normal Boys And Girls To Kiss And Get Paid! And Later, When We Get Them Alone, Will They Go Further, Even If They Don't Get Paid!？ 6

  • censoredcreampiebig titsHEZhot entertainmentnetsuyujinHEZ-253HEZ25359hez00253
    • 2021-02-06
    188 min

    [URE-063]Original Story: Naruto Chuka Naughty Uncle - Exclusive Mature Beauty's First Film! Chaste Married Woman Corrupted By Pleasure And Trained To Please Him - Faithfully Adapted To The Screen! Ririko Kinoshita

  • kinoshita rinko censoredmature womansingle workUREmadonnakitorune kawaguchiure.comiURE-063URE063ure00063
    • 2021-02-12
    74 min

    FC2PPV 1678683 ☆ 1000pt OFF until February 21st for a limited time! !! !! [None / Piece] Cooking with a sweet angel, Slightly Pocha Haru-chan, and a naked apron! !! The whole body was covered with chocolate ♪ ※ There is a face-up review privilege

  • amateur uncensoredfc2
    • 2021-02-13
    301 min

    [DVAJ-500]Nanami Kawakami Is Always A Slut: BEST

  • kawakami nanami censoredslutDVAJalice japanrabbit kandaDVAJ-500DVAJ500dvaj00500
    • 2021-02-22
    36 min

    FC2PPV 1697756 [No] ♯ Fair-skinned ex-girlfriend on a slope. I cooked a vaginal cum shot of ex-girlfriend with flirting on the bed.

  • amateur uncensoredfc2
    • 2021-02-26
    98 min

    300MIUM-678 Series No. 1 “Licking Devil”! !! !! [Nori best erotic deviation value SSS class beauty! !! !! ] × [Transcendence sensitive constitution & de M throat metamorphosis faucet Ma ● This is a violent tremor bicubic brain Iki conti

  • amateur censoredbig titsamateurmiummium-678mium678300mium-678
    • 2021-03-13
    62 min

    SIRO-4456 [First shot] [Beautiful receptionist with a gap] [With sincere service ..] Takamine’s flower standing at the reception is panting indecently and she feels too much and she begs for ejaculation with teary eyes .. On the net AV applicati

  • amateur censoredamateursirosiro-4456siro4456siro-4456
    • 2021-03-13
    49 min

    FC2PPV 1724493 Devil’s Blade-Semen Beam Bukkake Creampie by Youkai of the First String [No]

  • amateur uncensoredfc2
    • 2021-03-25
    44 min

    230ORETD-859 Minami

  • amateur censoredcreampieuniformoretdoretd-859oretd859230oretd-859
    • 2021-04-10
    108 min

    [VEMA-162]Plain Jane Secretary Is A Secret Slutty Wife Type With Big Tits! She's So Kind That She Doesn't Get Mad Even When I Cum Inside Of Her! Yukino Nagisa

  • yukino nagi censoredcreampiebig titsVEMAvenuskaniemegami venusVEMA-162VEMA162vema00162
    • 2021-04-14
    160 min

    [BLK-495]Sudden Reverse Pick Up Harem Wagon - These Tacky Girls Are On The Hunt For Cock And Won't Take No For An Answer! Aoi Kururugi Ichika Matsumoto

  • aoi kururugi ichika matsumoto censoredcreampieslutBLKkira kirathere is alsokira kira black galBLK-495BLK495blk00495
    • 2021-04-17
    133 min

    [DASD-854]Pretending To Be Seduced And Mercilessly Fucking! Devilish Teacher Ravishes The Moody S*****t President Nanase Asahina

  • asahina nanase censoredcreampieuniformDASDdaschinpo dazaiDASD-854DASD854dasd00854
    • 2021-04-18
    144 min

    [FLAV-266]HYPER FETISH High Leg Cut Slutty Queen Natsuho Imai

  • natsuho imai censoredslutsingle workFLAVdigital arkdigital ark digital arkFLAV-266FLAV266flav00266
    • 2021-04-27
    65 min

    FC2PPV 1790266 ★ First shot amateur ☆ I love H ♥ Onanist Yasushi with excessive libido 22 years old ☆ Erotic beauty BODY ♥ Pussy soaked Iki ♥ Gonzo raw squirrel cum shot on iron man ♥ [Personal shooting] * With benefits

  • amateur uncensoredfc2
    • 2021-05-15
    42 min

    FC2PPV 1814099 [First shot / 42 minutes, 5 shots] (〒) Second year at a bank. Uncut cum swallowing with a lot of turbulence and blowjob that can not be imagined from a soft atmosphere ＃ 9

  • amateur uncensoredfc2
    • 2021-05-19
    90 min

    FC2PPV 1825851 [No amateur individual shooting] Insert it as it is from the roadside remote control cum to the devilish fucking bitch girl who is crazy about vaginal cum shot and exposed in the city, even if it is ◯ re! Fainting convulsions that blow

  • amateur uncensoredfc2
    • 2021-05-22
    175 min

    [DGCEMD-012]*Delivery Only! Bonus Video Included *First Lesbians Unleashed! When Aya Shiomi Got Some Hard Lesbian Training From Rena Aoi

  • aya shiomi blue censoredlesbianmature womanDGCEMDcelebrity friendsDGCEMD-012DGCEMD012dgcemd00012
    • 2021-06-01
    120 min

    [NACR-428]Daydreaming About My Son's Wife... Miyabi Midorikawa

  • midorikawa miyabi censoredcreampiebig titsNACRplanet plusbito sakurananakuruNACR-428NACR428h-237nacr00428
    • 2021-06-05
    158 min

    [FLAV-271]HYPER FETISH A Naughty Queen In A High-Cut Outfit This Horny Gal Is A Rude And Crude Voluptuous Big Ass Maneater Who Loves To Serve Up Hospitality With Her Divine Blowjob Technique Miki Maeshima

  • miki maejima censoredslutsingle workFLAVdigital arkdigital ark digital arkFLAV-271FLAV271flav00271
    • 2021-06-10
    107 min

    [XMOM-032]Newly-wed Wife - Just One Week After Her Wedding She Tastes Another Man's Dick. Ameri Hoshi

  • star ameri censoredmarried womanmature womanXMOMcenter villagemurakipink breathXMOM-032XMOM032h-086xmom00032
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-20
    47 min

    FC2PPV 1879028 Today’s limited [Individual shooting] Runaway girl Ⓧ Pleasure The girl’s treatment technique that she learned. Gonzo at the accommodation fee * No main story moza

  • amateur uncensoredfc2
    • 2021-06-25
    163 min

    [BANK-044]Raw Sex In The Outdoor Bath Sexy Slut With World Class Soft I-Cup Titties

  • censoredcreampiebig titsBANKpussy banktake chanBANK-044BANK044h-1495bank00044
    • 2021-06-26
    120 min

    [KSBJ-143]And Then, I Stopped Being Satisfied With My Husband... Chitose Shinohara

  • chitose shinohara censoredcreampiebig titsKSBJksb kikaku emmanuellebito sakuraKSBJ-143KSBJ143ksbj00143
    • 2021-07-09
    139 min

    [EBOD-839]Ultimate Skinny Big Boobs Extreme Beauty Proportions Mistress Shakes Her Hips So Hard It Looks Like She'll Break Them Hedonistic Mating Adultery Trip Miyuki Arisaka

  • arisaka miyuki censoredcreampiebig titsEBODe bodymishima rokusaburoEBOD-839EBOD839ebod00839
    • 2021-07-09
    122 min

    [UMD-787]Alone With My Female Boss I Long For... 6

  • riho fujimori kiyoshi maihara censoredhandjobUMDleodragon nishikawaUMD-787UMD787125umd00787
    • 2021-07-09
    34 min

    FC2PPV 1892532 [Mitsuha] Blame the glans until the tide blows with a big smile! A man’s squirting with a pursuit handjob that does not stop even if it gets caught! part49 [Small Devil OL]

  • amateur uncensoredfc2
    • 2021-07-14
    55 min

    494SIKA-095 3P Saddle A Desire Throat Lewd Gal With A Big Cock

  • amateur censoredamateurbukkakesikasika-095sika095494sika-095
    • 2021-07-23
    58 min

    [asgm-012]さり

  • amateur censoredcreampieuniformasgmasgm-012asgm012asgm-012
    • 2021-07-30
    165 min

    [SSIS-143]Newcomer NO.1 STYLE Subaru Wachi AV Debut

  • wachi subaru censoredbig titsbeautiful girlSSISs1 no 1 stylearashiyama michiruSSIS-143SSIS143ssis00143
    • 2021-07-31
    116 min

    [MGMQ-077]Nympho Nurses At A Masochistic Sexual Clinic Who Anal Fuck The Men Staying There - Rika Tsubaki

  • tsubaki rika censoredanalhandjobMGMQmegamibijo shin queenMGMQ-077MGMQ077mgmq00077
    • 2021-08-20
    160 min

    [DASD-910]Deep Kissing And Hips Swinging, A One Night Hotel Stay Where She Can Show Her True Self: I"m In Heat And Can"t Let Go Of Your Cock Starring Mina Kitano

  • mina kitano censoredcreampiebig titsDASDdasmishima rokusaburoDASD-910DASD910dasd00910
    • 2021-08-21
    77 min

    200GANA-2541 Seriously Nampa, First Shot. 1679 Picking Up A Show Bread Gal That You Will Fall In Love With Long And Plump Legs! When You Beloch, There Is A Nasty Thread On The Sexy T-Back …

  • amateur censoredsquirtingamateurganagana-2541gana2541200gana-2541
    • 2021-09-15
    102 min

    [KIRM-008]- Deep Throat Adultery - Yuria Nanamiya

  • yuria nanamiya censoredKIRMsanji s side dishdeep throatingsanji s side dish poleKIRM-008KIRM008h-1540kirm00008
    • 2021-09-15
    67 min

    300MAAN-696 [Beautiful Breasts X Nice Bottom X Beautiful Girl’S Full Spec Girls Advent] Staying Date Going To Tokyo To Graduate From A Virgin! "Etch Is Important For Compatibility", So Take An Open-Air Bath Together And First Of All, For

  • amateur censoredcreampieamateurmaanmaan-696maan696300maan-696
    • 2021-10-06
    49 min

    229SCUTE-1133 Mahiro (25) S-Cute Delicate Black-Haired Loli Girl And Naughty (Mahiro Ichiki)

  • amateur censoredamateurbeautiful girlscutescute-1133scute1133229scute-1133
    • 2021-10-23
    256 min

    [ROOM-029]The Party That Got Creampies From the Old Guys!!

  • censoredcreampiebeautiful girlROOMhomeroom delusion grouphome room home room delusion groupROOM-029ROOM029room00029
    • 2021-10-25
    57 min

    [SHH-030]Cheating At The Massage Parlor With My Wife Right Nearby. Soothing Massage While Slipping My Dick In For Hip Shaking Cowgirl Fucking And A Creampie Load For The Perfect Ass On This Esthetician.

  • censoredslutSHHnatural highkansukeSHH-030SHH0301shh00030
    • 2021-11-05
    292 min

    [HUNTB-141]I"m The Only Guy At My School And Spring Cleaning Here, It"s A Panty Shot Heaven! A Panty Shot To See Everywhere You Look! 2 - This Was a Girls" School Till I Showed Up Last Year, Now I"m The Only Guy Here!

  • censoredcreampieschoolgirlHUNTBhunterkonnyaku kannohhh groupHUNTB-141HUNTB141huntb00141
    • 2021-11-20
    128 min

    [NSFS-044]The Japanese Fuck 11: A Wife Goes Crazy for the Man Who Fucked Her Shihori Kotoi

  • shiori kotoi censoredsingle workdramaNSFSnagae stylejotaro tomiNSFS-044NSFS044nsfs00044
    • 2021-11-21
    49 min

    230OREC-942 Kiu (Aihara Tsukiha)

  • amateur censoredcreampieuniformorecorec-942orec942230orec-942
    • 2021-11-22
    106 min

    374IMGN-030 Tin (24)

  • amateur censoredamateurbeautiful girlimgnimgn-030imgn030374imgn-030
    • 2021-11-26
    39 min

    480FRIN-060 [48-Year-Old Shinagawa Store] Hidden Camera Raw Sex Video Of A Mature Masseuse

  • amateur censoredcreampiemarried womanfrinfrin-060frin060480frin-060
    • 2021-12-10
    62 min

    328HMDN-434 Mana (Aina Shinkawa)

  • amateur censoredcreampiebig titshmdnhmdn-434hmdn434328hmdn-434



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download