planning javcensored jav documentary high vision




FC2VEMAGVHHNDSSISPPPDMILKAWDADNSPRDVENUSSNIBBANDASDLULUCHRVAPODABWWANZDASDSHKD

2020-11-14
53 min

C0930 ki201114 Request

  • amateur uncensoredc0930
    • 2020-11-20
    240 min

    [MGDN-141]Lower Halves On Display In The Dressing Room! Pranks On MILF Clerks - 240-Minute Special

  • censoreduniformblowjobMGDNstar paradisemegadonMGDN-141MGDN141h-254mgdn00141
    • 2020-12-14
    67 min

    FC2PPV 1606858 [First time limited 1980] Pure girls who worked at the airport take a gonzo because of hardship ❤️ 20-year-old Wakeari beauty ❤️ Insert an old man meat stick into a young pussy with strong vaginal pressure ❤️ Raw vaginal cum shot in th

  • amateur uncensoredfc2
    • 2020-12-21

    FC2PPV 1615243 * Limited privilege [Appearance] Prefectural Commercial Department ② Brass band club. Staying with a slender girl Creampie in a bristle pussy [45 minutes]

  • amateur uncensoredfc2
    • 2020-12-25
    46 min

    [ETQR-185][Daydream POV] Fucked And Impregnated Girl AIMI - Aimi Otosaki

  • aimi otosaki censoredcreampieuniformETQRerotic timeETQR-185ETQR185h-1186etqr00185
    • 2020-12-28
    56 min

    328HMDN-324 [Personal shooting] Boyish JD, a 20-year-old swimmer, is blamed for a muscle slender body and has abdominal muscle cracks while continuously alive.

  • amateur censoredcreampieamateurhmdnhmdn-324hmdn324328hmdn-324
    • 2020-12-30
    60 min

    Caribbeancom 123020-001 Quick Shooting: The Best of Meirin

  • meirin uncensoredcreampiehandjobcaribbeancom
    • 2021-01-01
    124 min

    [AMBI-116]The Secret Married Life Of My Homeroom Teacher and Me Sara Uruki

  • uryuki sara censoredcreampieblowjobAMBIplanet plusdirector oambibarentzAMBI-116AMBI116h-237ambi00116
    • 2021-01-09
    51 min

    C0930 hitozuma1344 Nana Tokutaka 27years old

  • amateur uncensoredc0930
    • 2021-01-09
    149 min

    [MIAA-377]Bathe Your Usachan Babes In Seed At The Creampie Reverse Soapland Brothel! -Breed Bunnies With Colossal Tits! - Honoka Tsujii

  • tsujii honoka censoredcreampiebig titsMIAAmoodyztrendy yamaguchieveryone s porn starMIAA-377MIAA377miaa00377
    • 2021-01-20
    118 min

    [OFKU-172]The Bride's Mother Who Came To Tokyo From Miyagi... 50-something Stepmom - Rumi Nitta

  • rumi nitta censoredcreampiemature womanOFKUstar paradisemom railOFKU-172OFKU172h-254ofku00172
    • 2021-01-22
    487 min

    [DPEC-020]Sticky Membranes Join As They Touch, Amidst The Pleasure Of Mind-Blowing Ecstasy As They Look Into Each Other's Eyes, They Rise To Orgasmic Heaven While Engaged In Hard And Tight, Deep And Rich, French Kissing Creampie Sex 30 Ladies 8 H

  • censoredcreampiemature womanDPECdynamite enterprisedynamite platinumDPEC-020DPEC020h-1386dpec00020
    • 2021-01-27
    127 min

    459TEN-011 [Extreme erotic degree No. 1] Charge to the home of an F cup gal captured in Shinjuku! !! Bombshell fuck with a special game underwear for gals! !! The scene is terrified by a drunken gal who gets erotic the more he gets drunk! !! !! Witne

  • amateur censoredbig titsamateurtenten-011ten011459ten-011
    • 2021-02-05
    189 min

    [WPS-003]WATER POLE - Michi - Himari Kinoshita: A Trendy Actress Exposes Everything And Tempts You With The Ultimate Eroticism!

  • himari kinoshita himari hanazawa censoredcosplaysingle workWPSrubyrintaro iseilluminatiWPS-003WPS003118wps00003
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-12
    120 min

    [MUDR-140]We've Been Waiting One Whole Year! Coquettishly Cute Local Broadcaster Shows Off Her Cowgirl SK**ls At Soapland Brothel In This Popular Let's Play Style Porno! Tsumugi Narita

  • narita tsumugi censoredcreampiebeautiful girlMUDRmukuMUDR-140MUDR140mudr00140
    • 2021-02-12
    164 min

    [BOKD-212]A Man's Daughter Is A Gal Bitch: I Might Look Like This, But I Have A Penis. Izumi

  • izumi censoredcreampiebig titsBOKDwe re she malesdorikawaBOKD-212BOKD212h-995bokd00212
    • 2021-02-27
    140 min

    [KNMB-010]Totally Raw [email protected] # Half In, Half Out # Totally Lolita # A Raw Pay-For-Play Girl # A Cheerful Idiot JK # The Strongest Way To Make Money # Her First Raw Pay-For-Play Fuck # Deep Pussy Creampie Sex Hikari Nozomi

  • hope light censoredcreampieschoolgirlKNMBfirst star100 raw styleKNMB-010KNMB010h-491knmb00010
    • 2021-03-06
    198 min

    [HUNTA-957]For One Price, You Can Fuck Anyone, For As Much As You Like! As Long As You Pay The Flat Monthly Rate, You Can Stick Your Dick Into Any Of the Female S*****ts Or Even The Female Teacher! Episode 0 0

  • censoredschoolgirlblowjobHUNTAhunterkorosukehhh groupHUNTA-957HUNTA957hunta00957
    • 2021-03-06
    71 min

    FC2PPV 1714892 [Personal shooting] ♀ 301LJ series ◯ -chan 18 years old 1st time The day after graduation, the world’s full appearance is conceived and vaginal cum shot AV debut and life ends at 18 years old!

  • amateur uncensoredfc2
    • 2021-03-11
    130 min

    [RCTD-389]Mature Professional Lesbians 2 ~ Stand Back And Jerk Off! ~

  • miki matsuzaka mio morishita censoredlesbianmature womanRCTDrocketkiyoshi miwaRCTD-389RCTD3891rctd00389
    • 2021-03-11
    127 min

    [MEKO-207]All-New "The Old-Lady-For-Rent" Service 10 This Housecleaning Service Will Provide Everything, Even Creampie Sex, So I Decided To Make Some Even More Extreme Demands

  • censoredcreampieamateurMEKOmilf laboMEKO-207MEKO207h-1160meko00207
    • 2021-03-14
    77 min

    345SIMM-620 I think I’m shy at Ubu, but I’m a bold girl who attacks nipples and spread legs at the woman on top posture! I stabbed my uncle chin into Ikuikuma Co ○ who is too sensitive, and decided a great continuous gachiiki! !! [A special

  • amateur censoredcreampieuniformsimmsimm-620simm620345simm-620
    • 2021-03-26
    70 min

    329EXMU-062 Satomi-chan

  • amateur censoredcreampieschoolgirlexmuexmu-062exmu062329exmu-062
    • 2021-04-16
    242 min

    [MXSPS-663]REQUEST Beautiful Sensitive Girls Nonoka Sakino

  • sakino flower censoredbeautiful girlMXSPSmaxingMXSPS-663MXSPS663h-068mxsps00663
    • 2021-04-29
    120 min

    [GS-2014]True Stories: Family Fun Special Extra Edition [29] Afterwards -

  • censoredGSgosGS-2014GS2014
    • 2021-05-05
    33 min

    279UTSU-512 Madoka-san

  • amateur censoredcreampiebig titsutsuutsu-512utsu512279utsu-512
    • 2021-05-13
    145 min

    [ABW-092]全裸家政婦 新感覚ヴァーチャルセックス性活をあなたに。 Staff01 愛音まりあ 【MGSだけのおまけ映像付き 10分】

  • amateur censoredamateurabwabw-092abw092abw-092
    • 2021-05-15
    34 min

    FC2PPV 1818390 There is a review privilege. Remi who became a shortcut is cute. Creampie was too comfortable. Personal shooting. Completely original.

  • amateur uncensoredfc2
    • 2021-05-29
    160 min

    [LULU-072]Your Girlfriend's Innocent Little Sister Is Visiting The Big City For The First Time Ever: You Can't Resist The Way She Flaunts Her Big Tits Without A Bra, And End Up Secretly Fucking Her Wild Every Single Day Nenne Ui

  • first love censoredcreampiebig titsLULUlunaticsvagmanLULU-072LULU072lulu00072
    • 2021-06-08
    139 min

    [ARM-986]Babes Get Guys To Blow Their Loads In Their Panties Part. 2

  • hamazaki mao mihina azumihina mihina nagai censoredslutARMaroma planninghamu oujiaromaARM-986ARM986arm00986
    • 2021-06-10
    138 min

    [RCTD-404]Imaginary Items Ultimate Evolution Series Real Wristwatch That Stops Time Freezing Time For The Whole Step Family And Having Some Fun Special

  • kiyoshi maihara rumi kodama censoredsistermomRCTDrockettaro kanbeRCTD-404RCTD4041rctd00404
    • 2021-06-10
    129 min

    [MEKO-211]The All-New "Old Lady Rental Service" 14 This Popular Housecleaning Service Will Do Whatever You Ask, Including Creampie Sex, So I Decided To Make An Even More Extreme Request

  • censoredcreampieamateurMEKOmature woman laboMEKO-211MEKO211h-1160meko00211
    • 2021-06-11
    39 min

    361SEKAO-156 Ash Hollywood from L.A

  • amateur censoredamateursekaosekao-156sekao156361sekao-156
    • 2021-06-19
    74 min

    418YSS-82 Sakura

  • amateur censoredbig titsamateuryssyss-82yss82418yss-82
    • 2021-06-26
    57 min

    FC2PPV 1889535 [Personal shooting] Kure is 18 years old with beautiful legs and big tits and vaginal cum shot in a convulsive pussy. [Mountain shooting]

  • amateur uncensoredfc2
    • 2021-06-28
    113 min

    300MIUM-726 Rookie OL of Spill F Cup and Summer Trip to Odawara! Spear-filled ● This is too hot ● This is a rare outbreak on the verge of burns! !! Plenty of sperm injection into the back of the vagina that is too hot! !! The vaginal cum shot that do

  • amateur censoredcreampiesquirtingmiummium-726mium726300mium-726
    • 2021-07-02
    177 min

    [SSIS-106]Sexy Slut Seduces Me By Straddling Me And Whispering Dirty Talk Right Into My Ear Even Though My Wife Is Right Next To Us Miru

  • miru censoredbeautiful girlslutSSISs1 no 1 stylenao masakiSSIS-106SSIS106ssis00106
    • 2021-07-08
    193 min

    [SUN-020]Orgy D***king Cum Surrounded By Dicks, I Just Want to D***k It. I Want To Fuck. Exposure Is Also OK. Convenient

  • mori nanako censoredbig titssingle workSUNsuntanaka baconSUN-020SUN02013sun00020
    • 2021-07-15
    130 min

    [LZDM-042]I Met The Hottest Girl During A Trip To The Boonies, She Frenched Me In The Sweltering Summer Heat And Turned Me Into A Lesbian - Erena Takeda, Tsubasa Hachino

  • elena takeda yano tsubasa censoredbig titssquirtingLZDMlesrerokusaburo mishimalezure dramaLZDM-042LZDM042lzdm00042
    • 2021-07-17
    146 min

    [DASD-893]She Received A Home Delivery Massage Service, And When He Excessively Kept Stimulating Her Private Parts, She Was No Longer Able To Resist The Pleasure, And Got Fucked. Honoka Tsujii

  • tsujii honoka censoredsingle workdramaDASDdasrokusaburo mishimaDASD-893DASD893dasd00893
    • 2021-07-22
    193 min

    [SSIS-165]Premium Edition Of Unreleased Footage! Saika Kawakita Has Trance Sex For The First Time! Arched Backs / Convulsions / Insane Climaxing Orgasms 180 Minute Special

  • ayaka hebei censoredsquirtingbeautiful girlSSISs1 no 1 stylexavier thomasSSIS-165SSIS165ssis00165
    • 2021-08-19
    241 min

    [AKDL-134]I Will Play With Your Nipples-Full Nipple Play! SUPER BEST

  • yui hatano yahashi bridge censoredbig titsbeautiful girlAKDLaquinorifsetaknrAKDL-134AKDL1341akdl00134
    • 2021-08-26
    101 min

    [SPRD-1451]From That Day When I Slept Next To My Stepmom - Hoka Nakayama

  • hoka nakayama censoredmature womansingle workSPRDtakara eizoutsukumo kyuutaaleddinSPRD-1451SPRD145118sprd01451
    • 2021-09-09
    104 min

    FC2PPV 2179701 Doll Half-Type 157 Cm 43 Kg Fair-Skinned Slender. "Is It Okay To Do Something Wrong With Her Teacher？"

  • amateur uncensoredfc2
    • 2021-09-10
    83 min

    [sqb-118]ももえ(23)

  • amateur censoredbig titsamateursqbsqb-118sqb118sqb-118
    • 2021-09-21
    115 min

    [SAN-022]Once Divorced Sexual Beast Can"t Repress Lust For Escorts, Chinatsu Asamiya

  • chinatsu asamiya censoredcreampiebig titsSANmazaisland watakanomother mazaSAN-022SAN022h-796san00022
    • 2021-09-25
    239 min

    [MCSR-455]Honestly Big Tits!! Real Creampie Raw Footage, Picking Up A Married Woman, No. 2, 10 Women, 4 Hours

  • censoredbig titsmature womanMCSRbigmorkalmasukattoMCSR-455MCSR45557mcsr00455



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download