peta




FC2AUKGADNGMEMCAWDMILKATIDMIAAMEYDFSDSSVENUSDABHMNNATRRBDBBANWANZMVSDABWNACRROYD

2021-01-15
115 min

[PARATHD-3089]Challenging A Sexy Mahjong Player! Raw Strip Mahjong Battle Until Morning, Fall 2015 Distilled Edition

  • nanase hitomi miwa watanabe censoredcosplayPARATHDparadise tvPARATHD-3089PARATHD3089parathd03089
    • 2021-01-15
    120 min

    [MDTM-694]It's My Graduation Soon, So... Tsumugi Narita

  • narita tsumugi censoredcreampiebig titsMDTMuchu kikakutodoMDTM-694MDTM694h-585mdtm00694
    • 2021-02-06
    104 min

    [SHKD-926]Jailbreaker - Natsu Tojo

  • natsu tojo censoredsingle workSHKDattackerskinsharkSHKD-926SHKD926shkd00926
    • 2021-02-06
    160 min

    [SSNI-985]Riri Nanatsumori's PLATINUM SOAP

  • nanatsumori riri censoredbig titssingle workSSNIs1 no 1 stylezaku araiSSNI-985SSNI985ssni00985
    • 2021-02-11
    50 min

    [gerk-347]りほ姉ちゃん

  • amateur censoredcreampieamateurgerkgerk-347gerk347gerk-347
    • 2021-02-12
    134 min

    [HONB-206]3 Gals Do Anything You Want

  • censoredamateurHONBmercurythe first shibuya special f e headquarHONB-206HONB206h-1133honb00206
    • 2021-03-06
    160 min

    [DVDMS-641]A Normal Boys And Girls Focus Group Adult Video We Followed These Team Members Who Had Consecutive Creampie Sex In The Bathhouse During Training Camp, And Checked Up On Them Afterward Too In This Special Everyone's Favorite Big Tits Fe

  • censoredcreampiebig titsDVDMSdeep syosukeDVDMS-641DVDMS641dvdms00641
    • 2021-03-16
    61 min

    Caribbeancom 031621-001 I’ma get wet!! Rei Kitajima

  • rei kitajima uncensoredcreampiehandjobcaribbeancom
    • 2021-03-21
    120 min

    [JUL-508]Steamy Sex ~ Married Nurse Gives Herself Up To A Patient's Warmth ~ Asahi Mizuno

  • mizuno chaoyang censoredbig titsmature womanJULmadonnarokusaburo mishimaJUL-508JUL508jul00508
    • 2021-03-26
    61 min

    328HMDN-348 [Individual, 60th Road] Miraculous 60th birthday wife 60 years old. Experience her climax for the first time in a quarter century by rich copulation with her youth and the tag comes off and begs for vaginal cum shot

  • amateur censoredcreampieamateurhmdnhmdn-348hmdn348328hmdn-348
    • 2021-03-28
    32 min

    508HYK-002 Ikeike Sister ＃ 02 Yuria J Cup Big Breasts Gal And Soap Play Cum Inside Sex.

  • amateur censoredcreampiebig titshykhyk-002hyk002508hyk-002
    • 2021-04-10
    151 min

    [CHRV-130]I Bumped Into My Stepsister For The First Time In Ages And Her Big Boobs Had Grown Into Colossal Tits! Shuri, She Went From A 40" H-Cup To A 43" J-Cup!

  • censoredcreampiebig titsCHRVcherry revolution daydream tribecherry s reboCHRV-130CHRV130chrv00130
    • 2021-04-18
    119 min

    [MGMQ-070]Chubby Teacher Plays With My Ass And Teaches Me The Pleasures Of The Anus Rian Isaki

  • rian isagi censoredanalslutMGMQmegamithe beautiful goddess queenMGMQ-070MGMQ070mgmq00070
    • 2021-04-20
    223 min

    [SDNM-277]Soothing Masseuse With A Smile That Will Make You Want To See Her Again - Yuhi Izumi, 33, AV Debut

  • izumi freezing censoredbig titssingle workSDNMsod createzaku araigenuine married woman the porn experienSDNM-277SDNM2771sdnm00277
    • 2021-05-11
    139 min

    [KUSE-016](Bust Your Nut In 4k!) Coco Sanchez , Age 19, From Puerto Rico "I Want You To Tease Me." This Adorable Exchange S*****t Will Blow Your Mind With Her Sex SK**ls - Her Porn Debut

  • coco sanchez censoreddeepthroatsingle workKUSEsod createinoue japanthis actress style is amazingKUSE-016KUSE0161kuse00016
    • 2021-05-11
    94 min

    300NTK-568 Super Special Grade Kyun Kawa Tall Beauty Appears! !! Seriously Seriously Seriously! !! A beautiful girl who is too envious and too beautiful! !! What’s more, it’s a SEX vessel that attacks with SEX enjoyment and has a very sensi

  • amateur censoredcreampieamateurntkntk-568ntk568300ntk-568
    • 2021-05-17
    37 min

    498DDH-015 [Deliher Voyeur] A super delicate younger sister with a waist of 54 cm, a beautiful small breasts deli lady wears erotic costumes on a tiny body and serves the production!

  • amateur censoredcreampieamateurddhddh-015ddh015498ddh-015
    • 2021-05-27
    56 min

    C0930 ki210527 Kazumi Okamoto 26years old

  • amateur uncensoredc0930
    • 2021-06-01
    248 min

    [ZMAR-043]Totally! Yui Hatano

  • yui hatano censoredcreampiemature womanZMARplanet plusmaruttoZMAR-043ZMAR043h-237zmar00043
    • 2021-06-02
    124 min

    [KCK-013]Raising Boys 13 Masochist NH Spoiled Subordinate Himena Himena Takahashi

  • takahashi himena censoredbdsmKCKsanwa publishingclick manKCK-013KCK013h-019kck00013
    • 2021-06-04
    156 min

    [SSIS-079]Directed To Take The Longest Dry Spell In Our Label's History: Sex Prodigy 'Miru' Has Gone Without An Orgasm For Three Whole Months! We Send Her To The Homes Of Amateur Fan Where She Goes Off Script To Satisfy Her Ravenous Carna

  • miru censoredsquirtingbeautiful girlSSISs1 no 1 styleichigoharaSSIS-079SSIS079ssis00079
    • 2021-07-01
    120 min

    [NACR-438]An Outrageous Promise With My Husband's C***d From A Previous Marriage. Yuri Sasahara.

  • yuri sasahara censoredcreampiemature womanNACRplanet plussakura ninshichi ku ryuuNACR-438NACR438h-237nacr00438
    • 2021-07-02
    34 min

    520SSK-012 Erika

  • amateur censoredcreampiesquirtingsskssk-012ssk012520ssk-012
    • 2021-07-10
    125 min

    [SABA-709]Karina is a 33-year old horny housewife with short hair lusting for big cocks and NTR. On the day of her ovulation, she's told by her frigid and infertile husband with erectile dysfunction to go and make babies in a hotel from morning t

  • censoredcreampieSABAskyu shirototodoSABA-709SABA709saba00709
    • 2021-07-10
    119 min

    300MAAN-672 [Two Idol Class CAs Collectively Brush Down] Netri Jupo Blow Shows The Professional Soul Of Hospitality In Front Of Her Boyfriend & Waist Swing Cowgirl And Virgin Immediately Cum Inside 3P! Reconciliation SEX with a boyfriend is a rain

  • amateur censoredcreampiebig titsmaanmaan-672maan672300maan-672
    • 2021-07-18
    25 min

    FC2PPV 1927857 [No] [Appearance] Sakura-Chan And Nuruteka Lotion Bath ♡ Creampie Sex With Invisibility Swimsuit Cosplay ♡ Review Benefits Available ☆ Only The First 50 Bottles 1600pt

  • amateur uncensoredfc2
    • 2021-08-12
    58 min

    FCP-034 [Delivery Only] Instead Of Angry Waves, Double Facial Cumshots! !! The Limit To Squeeze Until Empty!

  • amateur censoredamateurslutfcpfcp-034fcp034fcp-034
    • 2021-08-28
    239 min

    [HUSR-241]We Went Overseas And Seduced A Beautiful Mature Woman! She Looks Quite Demure But She"s An Otherworldly Slut! Serious Sex With Beautiful Blonde Babes! 6 Ladies 4 Hours

  • nina hartley censoredmarried womanamateurHUSRbig mocalbooker thustleHUSR-241HUSR24157husr00241
    • 2021-08-29
    49 min

    229SCUTE-1126 Mao (21) S-Cute Shrimp Warp Feeling Sex

  • amateur censoredsquirtingamateurscutescute-1126scute1126229scute-1126
    • 2021-09-04
    55 min

    Caribbeancom 090421-001 Adult Kindergarten: A Student Has Sex With Big Tit Teacher Honoka Orihara

  • honoka orihara uncensoredhandjobcaribbeancom
    • 2021-09-11
    226 min

    [BAZX-306]Dirty POV Sex With An Admired Coworker vol. 003

  • censoredBAZXk m producetodobazookaBAZX-306BAZX306bazx00306
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-24
    86 min

    529STCV-018 Natsu (Natsu Tojo)

  • amateur censoredcreampieamateurstcvstcv-018stcv018529stcv-018
    • 2021-09-25
    118 min

    [NSFS-027]THE Japanese Girls 10: Wives Getting Fucked By A Crazy Guy - Kanade Tsuchiya

  • kana tsuchiya censoredsingle workdramaNSFSnagae styletomitake taroNSFS-027NSFS027nsfs00027
    • 2021-09-28
    74 min

    FC2PPV 2262457 Finally 3P! Reina-Chan’s First Multiple Play That Was Trained From An Amateur And Finished Perfectly!

  • amateur uncensoredfc2
    • 2021-10-01
    207 min

    [MIDE-974]Newcomer, Star Gemstone Found In A "Normal" Exclusive 19 Year Old Porn Debut, Mio Ishikawa

  • ishikawa mio censoredbeautiful girlsingle workMIDEmoodyzusapyonmoodyz divaMIDE-974MIDE974mide00974
    • 2021-10-08
    80 min

    [REGOD-081][AI Remastering Edition] A Big-Titted MILF Just For Me Nao Oikawa

  • nao oikawa censoredbig titsREGODwarp entertainmentkingdomgoneREGOD-081REGOD0812regod00081
    • 2021-10-23
    236 min

    [OKAX-786]Horny Wives Masturbation Sessions - 30 Girls, 4 Hours - Vibrator And Finger Fun For Pussies And Clits - Enjoy The View Of Their Very Own Special Private Time

  • censoredOKAXk m produceoomei jirouokazuOKAX-786OKAX786okax00786
    • 2021-11-06
    153 min

    [SABA-732]Sharing A Hotel Room With My Coworker After We Went Out And Missed The Last Train... She Seemed So Unguarded, I Couldn"t Resist Her... vol. 013

  • censoredcreampieamateurSABAs kyuu shiroutotodoSABA-732SABA732saba00732
    • 2021-12-03
    104 min

    [FTHT-035]Puffy Areola! Hard Nipples! H-cup 100cm! Big Tits Are Her Lineage! Better Thank Her Ancestors Who All Had Big Tits Too! Deep Well Of Cleavage! 5cm Areola! 1.5cm Nipples! The Perfect Golden Ratio! Full-body Oil Rub-down... Testing A Theory:

  • censoredcreampiebig titsFTHTfaleno tubedavielfalenotubeFTHT-035FTHT0351ftht00035
    • 2021-12-05
    73 min

    444KING-058 Akari (Hayami Nana)

  • amateur censoredcreampiesquirtingkingking-058king058444king-058
    • 2021-12-05
    17 min

    FC2PPV 2491169 Ramen Shop ③ Please Purchase Only If You Understand It Because It Is A Special Content.

  • amateur uncensoredfc2
    • 2021-12-24
    81 min

    355OPCYN-220 Miku (Miku Kurusu)

  • amateur censoredcreampieamateuropcynopcyn-220opcyn220355opcyn-220
    • 2021-12-27
    32 min

    FC2PPV 2547841 [Personal Shooting, 4P Orgy, Pt Off For A Limited Time] A Mature Wife In Her 40s Who Tastes The Difference Between Three Meat Sticks.

  • amateur uncensoredfc2
    • 2022-01-07
    175 min

    [NKKD-241]This is My Wife (33) Getting Fucked by My Part Time Employee (20, virgin) -> It was Hard on Me, so Please Release this AV as is. (Virgin Hunter Series).

  • censoredbig titsNKKDjet eizomanji groupNKKD-241NKKD241nkkd00241
    • 2022-01-13
    135 min

    [STARS-520]【拘束・巨根・失禁】×激ピストン 痙攣するほどイカサレテ 月乃ひな

  • tsukino hina censoredsquirtingSTARSsod createakai suiseisod starSTARS-520STARS520
    • 2022-02-06
    82 min

    444KING-065 Riko

  • amateur censoredcreampiesquirtingkingking-065king065444king-065
    • 2022-02-18
    120 min

    [SSIS-330]I Want To Be Between Such Colossal Tits... Men Cannot Stand This Titty Fuck. A Bitch With Hot Tits Who Makes Cocks All Hard And Wet - Mei Washio

  • mei washio censoredbig titsslutSSISs1 no 1 stylegoemonSSIS-330SSIS330ssis00330



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download