orecs




FC2SANEBODMILKADNAPODSPRDMEYDSHKDAVSAVEMACHRVMVSDGMEMNACRSQTEJULBLKROYDHDKAVENU

2020-11-07
47 min

FC2PPV 1560800 [Uncensored / No Mo] Buyer review benefits available (high quality version) _ [It’s not bad to take it off] Nagisa / 22 years old / Salesperson [Complete appearance] Clothed creampie SEX

  • amateur uncensoredfc2
    • 2020-11-12
    166 min

    [HAWA-228]She Looks Like A Tough Young Mama, But Deep Down Inside, She's A Horny, Monstrous Blowjob Lover!! She'll Suck All Of Your Semen Dry With A Wicked Smile Natsuki 33 Years Old

  • censoredblowjobHAWAcosmos eizohidemonkcosmospictures soft on demandHAWA-228HAWA2281hawa00228
    • 2020-11-12
    243 min

    [SW-737]I Became a Teacher In Order To Have Sex With Cute Female S*****ts! 7

  • censoredbig titsSWswitchswitch switchSW-737SW7371sw00737
    • 2020-11-13
    117 min

    [DASD-754]Amy Fukada Gets Possessed By A Dirty Old Man He Took Over This Girl With Light Skin And Big TIts, And Fucked Her Boyfriend In Her Body

  • emi fukada censoredbig titssingle workDASDdasrokusaburo mishimaDASD-754DASD754dasd00754
    • 2020-11-13
    159 min

    [HGOT-061]This Shared Living House Has Outlawed Sex, But Today, When It Became Apparent That These 6 Boys And Girls Have Been Fucking Like Crazy, They Started Going Buck Wild With Lawless Large Orgies

  • kato momoka hikaru konno censoredcreampieblowjobHGOTjohnny shibuyaHGOT-061HGOT061h-1414hgot00061
    • 2020-11-18
    60 min

    Caribbeancom 111820-001 Quick Shooting: The Best of Satomi Suzuki

  • satomi suzuki uncensoredcreampiecaribbeancom
    • 2020-11-21

    FC2PPV 1579080 Limited number [None] Continuous vaginal cum shot to sensitive CA (69 minutes)

  • amateur uncensoredfc2
    • 2020-12-11
    121 min

    [KBI-048]Married Female Teacher Completely Gives In To Pleasure. Her Beastly Male S*****ts Make Her Their Plaything And Have Her Keep Licking Their Cum-Soaked Cocks... 4 Creampies!!! 10 Facial Shots Bukkake!! Honoka Yonekura

  • hoika yonekura censoredcreampiemature womanKBIprestigeshimikkikanbiKBI-048KBI048118kbi00048
    • 2020-12-12
    119 min

    [MEYD-643]The Horny MILF At My Part-Time Job Is My Very Own Personal Cum Dumpster Ayaka Mochizuki

  • ayaka mochizuki censoredcreampiesquirtingMEYDtameike goroMEYD-643MEYD643meyd00643
    • 2020-12-18
    235 min

    [SIM-101]"I Love You Teacher!" #To The M*nistry Of *ducation, I'm Sorry! #A J* & Teacher After School Raw Fuck Club

  • censoredcreampiecosplaySIMprestigeshirotomanmanSIM-101SIM101118sim00101
    • 2020-12-24
    69 min

    H0930 ki201224 Mineko Kushida 45years old

  • amateur uncensoredh0930
    • 2021-01-21
    151 min

    Caribbeancom 012121-001 Loli Girl Anthology Mihono, Mao Sena, Wakaba Onoue, Riko Tabe, Nagisa

  • mihono mao uncensoredcreampiehandjobcaribbeancom
    • 2021-01-21
    41 min

    FC2PPV 1654089 [Limited quantity] Mari-chan, a whip whip surfer gal, has lost communication, so it will be delivered at once including past works. Many purchase benefits

  • amateur uncensoredfc2
    • 2021-01-21
    122 min

    [HAVD-1004]Unleashed Lesbian Sisters: Sweet Kisses, Melting Touches, Addictive Lesbian Sex

  • blue mamiya nagi censoredlesbianHAVDhibinodr torihamaHAVD-1004HAVD10041havd01004
    • 2021-01-22
    241 min

    [AMA-068]A Sexual Genius A Shocking Horny Amateur Test Shoot These Real Amateur Babes Are Here Test The Limits Of Their Sexual Talents For The PRESTIGE Label vol. 68

  • censoredbig titsamateurAMAprestigeamateurAMA-068AMA068118ama00068
    • 2021-01-24
    63 min

    299EWDX-345 The F cup 145cm mini loose fluffy wife was a carnivorous wife who pleaded for a kiss from herself!

  • amateur censoredmarried womansquirtingewdxewdx-345ewdx345299ewdx-345
    • 2021-01-31
    365 min

    [VEQ-183]Ultra Hot MILF: Complete File - Yuka Mizuno 6 Hours, Part Three

  • yuka mizuno censoredcreampiemature womanVEQvenusmegami venusVEQ-183VEQ183veq00183
    • 2021-02-18
    238 min

    [HUNTA-951]This Blowjob Should Be Illegal! She's Crazy For Dick Sucking! My Little Stepsister Is A Cock Sucking Freak! I Suddenly Got A New Little Stepsister, And She Turned Out To Be A Super Horny Slut Who Will Start Sucking Anyone's Dick An

  • censoredcreampieschoolgirlHUNTAhuntermorikihhh groupHUNTA-951HUNTA951hunta00951
    • 2021-03-06
    119 min

    [SSIS-008](Abnormal Extreme Climaxes) The Ultimate Erotic Awakening! Waves Of Surging Nonstop Carnal Passion Until She's Totally Satisfied Rena Kodama

  • kodama rena censoredsquirtingbeautiful girlSSISs1 no 1 styleichigoharaSSIS-008SSIS008ssis00008
    • 2021-03-18
    262 min

    [AKDL-095]I Met An Amateur On Thursday 2 (Facial + Dental Assistant + Big Tits + POV + Married Woman + Masochistic Girl)

  • censoredamateurAKDLaquinoriaquinoriaknrAKDL-095AKDL0951akdl00095
    • 2021-03-18
    141 min

    [HUNTA-967]At The Cultural Fair, The Year 3 Class 6 Team Put Out Their Special Booth ... The Haunted House. Welcome To The Cultural Fair At A School For Young Ladies. At This Super Popular Booth, Where People Are Lining Up Around The Block, "Visi

  • censoredcreampieschoolgirlHUNTAhuntermasanorihhh groupHUNTA-967HUNTA967hunta00967
    • 2021-03-26
    240 min

    [OKAX-716]Sexy Older Women + Ultra Small Camera Incredible Titillating Footage ~ 40, 50, And 60 year Old Escort Version H

  • censoredamateurmature womanOKAXk m producedick mandokuokazuOKAX-716OKAX71684okax00716
    • 2021-04-10
    127 min

    [APNS-236]I Was Just Sent The Video Of My Beloved Ex-Fiance Getting G*******ged On DVD... Rin Kira

  • kira rin censoredcreampiesingle workAPNSaurora project annexyukihiro nasuaurora project anexAPNS-236APNS236apns00236
    • 2021-04-15
    240 min

    [OKAX-728]Penetrative Sex Negotiation At A Massage Parlor With Only Beautiful Young Wives Rough Sex Caught On Film WIth A Small Camera 240 Minutes

  • censoredmarried womanmature womanOKAXkm producedick poisonside dishesOKAX-728OKAX728okax00728
    • 2021-04-20
    240 min

    [TKBN-025]An Adultery Trip That Will Expose Their Lust Riko Honda Miki Sunohara Yuki Jin

  • honda future sunohara censoredTKBNstar paradisetreasure shipTKBN-025TKBN025h-254tkbn00025
    • 2021-06-11
    120 min

    [MUDR-152]Ever Since That Day... Beautiful Y********l In A School Uniform Is Tied Up, Trained, And Filled With Cum Mitsuha Higuchi

  • mitsuha higuchi censoredcreampiebdsmMUDRinnocentMUDR-152MUDR152mudr00152
    • 2021-06-12
    138 min

    [TPIN-005]His Wife Is Right Beside Him, But ... While Giving Her Husband A Massage, This Massage Parlor Therapist Secretly Slipped His Cock Into Her Pussy And Hid The Deed Underneath Her Skirt And Creampie Fucked Him, And He Could Nothing But Go With

  • censoredcreampieTPINchinpoinTPIN-005TPIN005tpin00005
    • 2021-06-19
    121 min

    [NNPJ-455]Outdoor Kissing S********ls - Car Date Moves To A Love Hotel For 6 Raw Loads

  • censoredcreampieuniformNNPJnanpa japanNNPJ-455NNPJ455nnpj00455
    • 2021-07-10
    245 min

    [KDMI-037]Wonderful Queen Amazing

  • ayane sezaki takarada monami censoredKDMImilldopamixKDMI-037KDMI037kdmi00037
    • 2021-07-17
    177 min

    [HMN-024]Whispered Temptation Leads To Creampie Sex Right Beside Your Girlfriend Ai Mukai

  • ai mukai censoredcreampieslutHMNhon nakanao masakiHMN-024HMN024hmn00024
    • 2021-08-21
    149 min

    [AVSA-177]Little Devil Hottie"s Tempting Closeup Macro, Sakura Tsuji

  • sakura tsuji censoredcreampiebig titsAVSAavsjinguuji hikariavscollectorsAVSA-177AVSA177avsa00177
    • 2021-08-26
    227 min

    [SW-794]"Let"s Share A Bath!" Cousin"s Step-sisters Who Teases Me Shows Their Big Tits Off In Our Bath Together! Dick Reacts In No Time To Fondling And Bathing Breasts. Keeping It Hidden And Trying Hard Not To Cum!

  • censoredbig titsSWswitchyocchanswitch hibinoSW-794SW7941sw00794
    • 2021-09-01
    120 min

    [GVH-284]Dirty Wife With No Bra And Panties Moves In Next Door Karen Asahina

  • karen asahina censoredslutsingle workGVHglory questkisakura kabinGVH-284GVH28413gvh00284
    • 2021-09-04
    70 min

    H4610 tk0042 Erina Terama 20years old

  • amateur uncensoredh4610
    • 2021-09-04
    135 min

    [FLAV-279]The Big Ass Maid With Perky Nipples And Massive Tits Loves To Offer Her Perverted Services. Monami Takarada

  • takarada monami censoredslutsingle workFLAVdigital arkdigital ark dejitarua kuFLAV-279FLAV279flav00279
    • 2021-09-23
    101 min

    [SPRD-1463]Stepmom Seduced By Horny Stepson Ryouko Izumi

  • ryoko izumi censoredmature womansingle workSPRDtakara eizoutsukumo kyuutaaleddinSPRD-1463SPRD146318sprd01463
    • 2021-10-02
    65 min

    398CON-086 Keiko (34)

  • amateur censoredcreampiemarried womanconcon-086con086398con-086
    • 2021-10-19
    35 min

    275OCHA-097 Tin

  • amateur censoredcreampieschoolgirlochaocha-097ocha097275ocha-097
    • 2021-10-23
    97 min

    FC2PPV 2367108 [Individual Shooting 59] Complete Appearance Prefectural K ③ Super Loli Suji Pie Bread Cleaning Fellatio After Re-Injection Many Times From Continuous Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-11
    34 min

    FC2PPV 2422000 [Personal Shooting] Licking The Gravure Girl In The Weekly Manga Magazine [Caution For Withdrawal] [cen]

  • amateur uncensoredfc2
    • 2021-11-15
    50 min

    [SHH-031]Naughty Massage Parlor Slut Secretly Rubs Your Cock While Calmly Giving You A Massage While Your Wife Is Right Beside You. Then She Slips Your Dick Inside Her And Rides You Cowgirl Style Until You Give Her A Creampie

  • censoredslutSHHnatural highkansukeSHH-031SHH0311shh00031
    • 2021-11-16
    66 min

    C0930 ki211116 Shinobu Kawahara 28years old

  • amateur uncensoredc0930
    • 2021-12-04
    70 min

    422ION-0088 Personal Shooting Of A Beautiful Girl Who Loves Gonzo Gonzo (Mizuki Yayoi)

  • amateur censoredcreampiebig titsionion-0088ion0088422ion-0088
    • 2021-12-09
    130 min

    [STARS-454]全身隈なくねっとり舐められながら密着性交 青空ひかり

  • aozora hikari censoredsoloworkSTARSsod createoosaki hirokoujisod starSTARS-454STARS454
    • 2021-12-14
    480 min

    [MUCH-142]8 Hours And 2 Discs Of Sex With 10 Women With Big Tits And Shaved Pussies

  • enomiya shiori tsukada censoredbig titsMUCHmothermuchimuchiMUCH-142MUCH142h-796much00142
    • 2021-12-31
    119 min

    [CAWD-327]"I"m Not Going To Stop Sucking. After All, We Haven"t Even Fucked Yet." A Blowjob-Loving Barely Legal Babe With Sexy Lips Will Make You Cum Over And Over Again Before You Even Stick Your Dick Into Her Maki Tsuji

  • maki tsuji censoredbig titsblowjobCAWDkawaiiinaballCAWD-327CAWD327cawd00327
    • 2022-01-03
    67 min

    SIRO-4745 [First Shot] [Baby Face Slender] [Systemic Erogenous Zone] A Minimal Jd With A Glittering Smile That I Applied For With My Twin Sister. When An Innocent Facial Expression Swells With Pleasure And Dies While Cramping A Delicate Body .. AV Ap

  • amateur censoredamateursirosiro-4745siro4745siro-4745



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download