older sister planning censored high vision javcensored




FC2NACXCESDMILKCJODKBIPREDSHKDSQTEMIDEDTTGMEMNACRVENUJUFEDASDRBDSSNIAPODKSBJPPPD

2020-10-22
59 min

299EWDX-329 Arisa 37 years old Super natural wife [Celebrity wife]

  • amateur censoredbig titsmarried womanewdxewdx-329ewdx329299ewdx-329
    • 2020-10-23
    48 min

    FC2PPV 1544040 I was in trouble with money and went to shoot. I will not talk deeply [Personal shooting]

  • amateur uncensoredfc2
    • 2020-11-01
    122 min

    [GS-1994]True Stories: Family Fun [46]

  • censoredGSgosGS-1994GS1994h-101gs01994
    • 2020-11-06
    482 min

    [QXL-140]Family Lesbian Fun 8 Hours, 2-disc Set

  • censoredmature womanQXLrubyQXL-140QXL140qxl00140
    • 2020-11-21
    32 min

    FC2PPV 1578724 Limited to consecutive holidays [Individual] Mother of three children with tall beautiful legs, late repayment Visit to the new address …

  • amateur uncensoredfc2
    • 2020-11-23
    139 min

    [ANZD-047]Real Life Kindergarten Teacher Makes A Porno! I'm A Naughty Girl Who Likes To Wet Myself... Yuka

  • censoredcreampieamateurANZDapricot mousouapricotANZD-047ANZD047anzd00047
    • 2020-11-27
    234 min

    [DOCP-261]"Seriously, Is She An Angel!？" I Was In The Hospital With Broken Bones And Couldn't Enjoy My Usual Masturbation, And Now My Cock Was At Its Limit! When This Beautiful Nurse Saw Me, She Felt It Was Her Mission To Care For Me, And

  • aya shiomi swan censoredcreampieslutDOCPprestigedoc premiumDOCP-261DOCP261118docp00261
    • 2020-12-06
    241 min

    [MMB-339]Momotaro Presents Natural Airhead Big Tits Best Hits Selection!!! 10

  • inaba kurata mao censoredbig titsMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-339MMB339mmb00339
    • 2020-12-18
    239 min

    [DNW-105]Mind-Blowing Daydream Theater 02

  • censoredcreampiebig titsDNWprestigedocumentDNW-105DNW105118dnw00105
    • 2020-12-20
    63 min

    413INST-080 [Gravure production outflow] Top secret personal photo session with that topical gravure idol

  • amateur censoredcreampiebig titsinstinst-080inst080413inst-080
    • 2021-01-09
    31 min

    279UTSU-487 Sakino

  • amateur censoredcreampiebig titsutsuutsu-487utsu487279utsu-487
    • 2021-01-23
    127 min

    [IKST-010]If You Want To Get Your Nookie With A Sexy Elder Sister Type, This One's For You! Mio Kayama Best Hits Collection Super Selections Just For You! Lots Of Super Rare Scenes In This Collection Of Premium Selections!

  • kayama yoshisakura censoredcreampiebig titsIKSTsuddenly eroticIKST-010IKST010h-1454ikst00010
    • 2021-01-26
    137 min

    1Pondo 012621_001 Runa Hinata : Runa Hinata Special Edition

  • amateur uncensored1pondo
    • 2021-02-06
    24 min

    FC2PPV 1675088 [3P Real NTR] Husband is away from work During the day, a married woman brings in two men and ejaculates on a bed sleeping with another person’s cock and a beloved husband

  • amateur uncensoredfc2
    • 2021-02-06
    60 min

    210AKO-417 UMI

  • amateur censoreduniformamateurakoako-417ako417210ako-417
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-12
    120 min

    [EBOD-802]When Will These Crushes Be Requited？ 4 Platonic Friends (2 Girls, 2 Guys) Watch A Porno Together And Get So Horny That They Finally Break The Ice With An Orgy Yukine Amasawa Rino Aisaka

  • yukine amazawa rino osaka censoreduniformbeautiful girlEBODe bodykitorune kawaguchiEBOD-802EBOD802ebod00802
    • 2021-02-15
    108 min

    300MIUM-679 A trip to Atami with a petite F-cup beautiful girl! The true identity of a beautiful girl who seems to be happy is a carnivorous romance strong man! A waruii woman who is proud of her short stature, big breasts, and peach butt! !! With a

  • amateur censoredcreampiebig titsmiummium-679mium679300mium-679
    • 2021-02-19
    117 min

    [DDHH-025]Confinement: New Book On The Aesthetics Of The Female Body - Aoi Tojo

  • tojo censoreddeepthroatsingle workDDHHdogmahidekiDDHH-025DDHH025ddhh00025
    • 2021-02-25
    123 min

    [RCTD-384]

  • shiiki walnut kohinata mai censoredlesbianmature womanRCTDrockettaro kanbeRCTD-384RCTD3841rctd00384
    • 2021-02-26
    239 min

    [SIM-111]This Real-Life Sch**lgirl Is Giving You A Slick And Slippery Lotion-Lathered Soapland Experience! First, She'll Give You Some Squishy And Sexy Pussy Grinding Action, But Then, Is That Your Cock, Slipping In Raw Into Her Pussy!？ Use Your

  • censoredcreampieuniformSIMprestigeshirotomanmanSIM-111SIM111118sim00111
    • 2021-02-28
    32 min

    FC2PPV 1706430 [No] Unauthorized pregnancy juice for a young wife with beautiful ass in a closed karaoke room …

  • amateur uncensoredfc2
    • 2021-03-01
    119 min

    [SMSD-022]Female Prisoner Illusion - Aya Shiomi

  • aya shiomi censoredbdsmsingle workSMSDs m sniperSMSD-022SMSD022h-1126smsd00022
    • 2021-03-04
    22 min

    HEYZO 2472 Moe’s Orgasms with Toys – Moe Nashiki

  • moe nashiki uncensoredhandjobheyzo
    • 2021-03-05
    480 min

    [TRE-155]Amateur TV X PRESTIGE - Ultra-Sensitive Girls - Incredible Episodes - BEST Collection Vol. 2 - Beautiful Young Babes With Sensitive Bodies Cum So Hard You Won't Be Able To Look Away!

  • censoredamateurTREprestigetreasureTRE-155TRE155118tre00155
    • 2021-03-12
    109 min

    300MIUM-692 [Beautiful legs 175cm x metamorphosis nursery teacher] Currently, a former nursery teacher who is short of money is caught in a pub, and a metamorphosis orgy party at a love hotel specializing in SM! ？？ : Ladder liquor 70 in Akasaka Mitsu

  • amateur censoredbig titssquirtingmiummium-692mium692300mium-692
    • 2021-03-13
    75 min

    FC2PPV 1724162 ☆ 700pt OFF until March 21st for a limited time! !! !! [No / individual] Punishment play with shy chubby Masami-chan and Pichi Pichi uniform ♪ * There is a face-up review privilege

  • amateur uncensoredfc2
    • 2021-03-19
    47 min

    [sika-060]通野ちゃん 2(27)

  • amateur censoredamateurblowjobsikasika-060sika060sika-060
    • 2021-03-22
    98 min

    241GAREA-501 Mizuki

  • amateur censoredbig titsamateurgareagarea-501garea501241garea-501
    • 2021-03-27
    136 min

    [KNMB-011]Totally Raw STYLE @ Rimi #Half-In, Half-Out #G-Cup Colossal Tits #True Nature #Her First Slutty Video #Busty S********l #Cum-Swilling Pussy #Sugar Babe #Creampie Rimi Momono

  • rimi momono censoredcreampiebig titsKNMBfirst star100 raw styleKNMB-011KNMB011h-491knmb00011
    • 2021-03-29
    66 min

    492JCHA-061 I’ll do it again after a short break! 6

  • amateur censoredamateurbeautiful girljchajcha-061jcha061492jcha-061
    • 2021-03-31
    59 min

    FC2PPV 1748356 A fashionable girl with green hair appears, a shy person, but a lot of disorder of personality sudden change, "Personal shooting" individual shooting original 115th person, raw squirrel

  • amateur uncensoredfc2
    • 2021-04-11
    62 min

    FC2PPV 1765021 First shot ♥ ️ Blonde short fair-skinned beauty big breasts with one-time melody seeding SEX! !! 【selfie】

  • amateur uncensoredfc2
    • 2021-05-30
    61 min

    HEYZO 2535 Do Me A Favor？ Dangling Money In Front Of An Amateur Girl!! – Rui Minazuki

  • rui minazuki uncensoredcreampiehandjobheyzo
    • 2021-07-13
    53 min

    521MGFX-009 Excavation ☆ Big Breasts Amateur 7

  • amateur censoredcreampiebig titsmgfxmgfx-009mgfx009521mgfx-009
    • 2021-08-07
    228 min

    [XRLE-013]Creampies Deep Down The Throat Of A Beautiful Girl: Breaking Her In For Deep Throats. Rena Aoi.

  • blue censoredbeautiful girldeepthroatXRLEk m produceani nakamurareal real worksXRLE-013XRLE013xrle00013
    • 2021-08-25
    114 min

    [ZOZO-077]The New Female Teacher"s Physical Examination Before Taking Up Her New Post - The Teacher Yuzu Shirakawa Edition

  • censoredZOZOsadie willenauZOZO-077ZOZO0771zozo00077
    • 2021-09-09
    59 min

    1Pondo 090921_001 Lesbian Sex: Nana Nanase and Rena Hiiragi

  • amateur uncensored1pondo
    • 2021-09-21
    511 min

    [TOMNVD-001]Beautiful Girl Orgasmic Awakening - Best Of. She Has An Innocent Face, But A Woman Is A Woman. Over 500 Minutes Of Footage.

  • white peach scooping censoredblowjobbeautiful girlTOMNVDteppanTOMNVD-001TOMNVD001tomnvd00001
    • 2021-10-07
    124 min

    [FSDSS-300]The Call Girl I Invite Over Ends Up Being My Bully, Hiyori... Leading To Wild And Crazed Fucking. Hiyori Yoshioka

  • hiyori yoshioka censoredsquirtingbeautiful girlFSDSSfalenonikusonfaleno starFSDSS-300FSDSS3001fsdss00300
    • 2021-10-15
    122 min

    [TPPN-208]The Return Of The Sure Thing Misuzu Kawana The High Tide Of Excitement, Slathered With Sweat, Bodily Fluids, And Cum The Furious, Crashing Waves Of Ultimate Pleasure

  • misuzu kawana censoredsingle workbukkakeTPPNteppanTPPN-208TPPN208tppn00208
    • 2021-10-15
    120 min

    [KAM-093]I Brought The Married Woman Part-Timer Home From A Work Party, And Took Hidden Camera Voyeur Footage Of Our Fucks, Then Secretly Sold It As Porn 7

  • censoredcreampiebig titsKAMkarumagroupKAM-093KAM093kam00093
    • 2021-10-16
    124 min

    [ZOCM-008]We"ll Deliver A Married Woman Slut To Your Door. Ai-san 29 Years Old Ai Kawana

  • ai kawana censoredcreampieslutZOCMzokuzoku musume mousouzokutodozokuzoku musumeZOCM-008ZOCM008zocm00008
    • 2021-10-21
    55 min

    SIRO-4672 [First Shot] [Small Animal Girl] [Young Beautiful Skin] A Cosmetology Student With A Friendly And Lovely Smile. With The Rushing Pleasure, Gradually Change The Smile To A Screaming Face And Announce The Climax Many Times With A High-Pitched

  • amateur censoredamateursirosiro-4672siro4672siro-4672
    • 2021-10-26
    120 min

    [SAN-024]She Was Fucked By Her Husband"s Employees ... A Wife With Light Skin, Beautiful Tits, And A Super Cute Anime Voice Kurumi Momota

  • hyakuta walnut censoredcreampiesingle workSANmazakisakura kabinmother mazaSAN-024SAN024h-796san00024
    • 2021-11-06
    120 min

    [NSFS-040]Mature Mother 16. Mother Who Allowed Son-in-law to Touch Her On Request Chisato Shoda

  • shota chisato censoredmature womanmomNSFSnagae styletomitake taroNSFS-040NSFS040nsfs00040
    • 2021-11-19
    240 min

    [REXD-386]A Sought-After Fresh Face Nun! The Perverted Chief Priest"s Eccentricity: "Wet Your Crack so that it is Soaking Wet Like This..."

  • censoredcreampieREXDredmanji groupREXD-386REXD386rexd00386
    • 2021-11-26
    41 min

    FC2PPV 2467089 Infiltrate A Secret Orgy ㊶ A Toy-Loving Chubby Girl ♥ Mass Leaked By Using Electric Massage Machine And Rotor Double ♥ After That, Mass Cum Shot W ※ High Quality Version & Review Benefits Included ♪

  • amateur uncensoredfc2



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download