office lady javcensored creampie jav dmm exclusive




FC2NNPJMIDVSSNIADNPPPDHMNPREDAMBIABWMILKNACRONEZVEMASANCAWDSQTECHRVAVSAHDKASHKD

2024-05-04
134 min

XVSR-755 Tonight, My Boss Is Embraced In Front Of My Husband ...~ Husband Betrayal And The Sex Guys Who Become The Sexual Man -Asami Nagase

  • asami nagase censoredcreampiebig titsXVSRmax ak c takedacalenXVSR-755XVSR755xvsr00755
    • 2024-05-03
    120 min

    MIMK-158 I Buzz On SNS!The Original Work Is Finally Live -action!Neighboring People Come To Borrow-live-action Version-Azuki Azuki

  • amatsuki azu censoredcreampiebig titsMIMKmoody skomatsu seventeenmankitsuMIMK-158MIMK158mimk00158
    • 2024-05-03
    160 min

    LULU-297 A Small Devil Big Ass Real Estate Yurinashi Maina, Whose A Couple"s Boyfriend Who Came To The Property Was Bruised By A Pit Bread Provocative And Invited Immediately To Cheating And Cum Shot Over And Over Again.

  • yuuri censoredcreampieLULUlunaticsnagases wingLULU-297LULU297lulu00297
    • 2024-05-03
    130 min

    YUJ-018 I Drowned In A Creampie Sex That Would Forget My Wife, Kissing Enough To Suffocate.Be Summer And Night

  • natsuya eru censoredbig titsslutYUJattackersthere is alsokidding girlYUJ-018YUJ018yuj00018
    • 2024-03-15
    240 min

    MIZD-374 Make Beautiful Legs & Beautiful Buttocks More Erotic!Black Pantyhose Clothes SEX4 Hours Best

  • ichika matsumoto scooping censoredcreampieschoolgirlMIZDmoody smoodyz bestMIZD-374MIZD374mizd00374
    • 2024-03-09
    129 min

    BACJ-102 I Was Brought To The Hotel By A Drunken Yariman Subordinate And Became An Infinite Ejaculation Toy.

  • kirika yuuri nia meru ito censoredcreampieslutBACJbaltan baltanaoi buttonwomen s sovereigntyBACJ-102BACJ102bacj00102
    • 2024-02-16
    120 min

    KAM-174 "It"s Scary To Even Look At Her Face!" Beautiful Office Lady Raped To Death By Her Pervert, Erotic Boss With A Huge Penis That She Hates - Sakura Tsuji

  • sakura tsuji censoredcreampieKAMkarmagroupKAM-174KAM174kam00174
    • 2024-02-16
    120 min

    PRED-561 When Asked, She Gets Wet To The Core...The Days When A Big-breasted Wife Indulges In Unfaithful Creampies With A Younger Man. JULIA

  • julia censoredcreampiebig titsPREDpremiumtrendy yamaguchielegancePRED-561PRED561pred00561
    • 2024-02-16
    115 min

    DVMM-068 On A Business Trip To A Local Area For 2 Days And 1 Night...Reverse NTR In A Shared Room Mei Itsukaichi, A Beautiful New Office Lady With A Promising Future, Will Give You Energy For Tomorrow With Her Boss"s Unaccustomed Dirty Talk And F

  • itsukaichi mei censoredcreampieslutDVMMdeepsfunky haseideep sDVMM-068DVMM068dvmm00068
    • 2024-02-16
    210 min

    HJMO-636 Specialized In Black Pantyhose That Are Damp On The Outside. A Shameful Game Where You Shake Your Hips With A Fixed Dildo. An Obstacle Race That Gradually Increases In Size And Makes You Cum In Agony! If You Can"t Reach The Goal Within T

  • censoredcreampieHJMOfirst plannagase wingHJMO-636HJMO636hjmo00636
    • 2024-01-19
    120 min

    FOCS-173 When I Called The Delivery Health Service, She Was The Most Humble Colleague In The Company! Is It Ok To Have Raw Sex If "please Keep It A Secret From The Company"？ From That Day On, I Do It Every Day! Creampie 3P! Fucking! Mai Onode

  • onodera mai censoredcreampieFOCSabc delusion groupfocusFOCS-173FOCS173focs00173
    • 2024-01-19
    170 min

    HUNTB-688 Drinking At Home → Mud → Lesbian → 3P Orgasm. Are Your Two Female Colleagues Lesbians？ It Wasn"t. He Was Just A Pure Lewd Slut. Frustrated In Front Of Me...

  • censoredcreampieHUNTBhunterkoichi davidsonhhh groupHUNTB-688HUNTB688huntb00688
    • 2023-11-28
    93 min

    550ENE-023 [Don"t You Know This Kind Of Woman？ 】A Beautiful Office Lady With High Consciousness But Low Sense Of Chastity Gets Creampied In Her Anus Until She Falls Into Awe Anal Club 007

  • amateur censoredcreampieamateureneene-023ene023550ene-023
    • 2023-10-29
    128 min

    RCON-006 Please Tell Me The Name Of This Actress! ! #Lookalike 001 A Mysterious And Extremely Cute Figure That Instantly Became A Hot Topic On SNS! Divine Style! Tall Beautiful Girl Gets Creampied And Gets Fucked With Facial Cum Shot SP

  • amateur censoredcreampiesquirtingrconrcon-006rcon006rcon-006
    • 2023-10-06
    143 min

    BONY-061 Sakina Mogami, A Compliant Employee Who Takes A Plain And Serious Girl With Glasses As A Nuisance

  • mogami sakina censoredcreampieblowjobBONYbonita delusional tribetsuru pintaroBONY-061BONY061bony00061
    • 2023-10-06
    170 min

    JUQ-399 A Business Trip Entertainment Where The Arrogant President Of A Business Partner Kept Getting Creampied. Exclusive Beauty, Good Woman"s Suit ``Beauty"". Mimio Tojo

  • tojo minoru mio censoredcreampiemature womanJUQmadonnahimrockJUQ-399JUQ399juq00399
    • 2023-09-30
    130 min

    MRHP-026 The Secretary Is So Pretty That I Can"t Stand It! It Doesn"t Matter If She"s A Married Woman Or Not, Yui Kato Cums Inside Her Every Day, Calling It The President"s Order.

  • kato yui censoredcreampieMRHPmrs emmanuelnortonmrs assMRHP-026MRHP026mrhp00026
    • 2023-09-20
    127 min

    300MIUM-942 NTR [Netorare] A Working Married Woman Who Has Ignited Her Desire! I Will Do Whatever I Want With Raw Sex And Creampie In Front Of My Husband! ! ! The Naughty Body With A Beautiful Waist And Beautiful Butt Cums At The End Of Excitement! !

  • amateur censoredcreampiemarried womanmiummium-942mium942300mium-942
    • 2023-09-10
    98 min

    535LOG-028 A Sharp And Tall Office Lady Who Is Able To Work Hard Is Spoiled By Her Pimp Boyfriend On The Weekends! ! Just As I Was Told, I Sucked His Dick In A Public Toilet And Swallowed It While Being Embarrassed! ! Naturally, NO Contraceptive Sex!

  • amateur censoredcreampieamateurloglog-028log028535log-028
    • 2023-08-16
    121 min

    300MIUM-934 An F-Cup OL With A Perverted Body Who Came To Get An AV Interview During Job Hunting! From The Morning To The Evening Of The First Day Of Joining The Company, I Will Follow You Relentlessly! ! At Home! On The Train! At The Hotel! Immerse

  • amateur censoredcreampiebig titsmiummium-934mium934300mium-934
    • 2023-07-08
    240 min

    SABA-839 Drunk Colleague Abandoned Without Permission AV Shooting 02

  • censoredcreampieSABAclass s amateurtodoSABA-839SABA839saba00839
    • 2023-06-30
    120 min

    MIAA-894 The Boss I Hate Is Too Striking... Sexual Harassment SEX Makes Me Squid To Death, Afterwards, Vaginal Cum Shot Sex Mito Wakui

  • wakui misato censoredcreampieblowjobMIAAmoody smamezawa mametaroeveryone s kikatanMIAA-894MIAA894miaa00894
    • 2023-06-23
    350 min

    REXD-476 Translation Of Property With Reason Is Your Crack Also A B-class Product With Reason？ Let Me Taste It...

  • censoredcreampieREXDredgroupREXD-476REXD476rexd00476
    • 2023-06-19
    79 min

    777YMYM-015 Yamiyami 012 / Erotic Siri Glasses OL / Yamiyami Alcohol Whose Smartphone Has Run Out Of Charge

  • amateur censoredcreampiebig titsymymymym-015ymym015777ymym-015
    • 2023-06-16
    120 min

    JUFE-469 Senpai, Is It Okay To Share A Room With Me？ A Busty Female Employee Who Loves Her Dull Middle-Aged Boss Is Tempted To Lick Her Thick Tongue Until Morning In A Shared Room On A Business Trip Rena Taozono

  • reina taoyua censoredcreampiebig titsJUFEfitchJUFE-469JUFE469jufe00469
    • 2023-06-16
    120 min

    MIDV-390 If You Stay At The House Of A Friendly Female Boss Who Becomes A Kisser When You Get Drunk After The Last Train At The Company Drinking ... 25 Vaginal Cum Shots In Infinite Berokisu Position Ibuki Aoi

  • aoi ibuki censoredcreampiebig titsMIDVmoody scaptain gangwonmoodyz divaMIDV-390MIDV390midv00390
    • 2023-06-16
    120 min

    PPPE-134 Sexual Harassment Boss I Hate And Breast Massage

  • aise yuuri censoredcreampiebig titsPPPEoppaiPPPE-134PPPE134pppe00134
    • 2023-06-16
    120 min

    KAM-132 "It"s Horrible To See Your Face!" A Beautiful Office Lady Who Is Squid To Death By Her Perverted Perverted Boss Who Hates Her Big Cock Rino Yuki

  • yuki rino censoredcreampiebig titsKAMkarmagroupKAM-132KAM132kam00132
    • 2023-06-16
    120 min

    EBOD-997 I Couldn"t Go Home Due To Heavy Rain During Overtime, So I Ended Up Staying At A Friendly Colleague"s House... I Was Excited By My Wet Beautiful Big Tits And Defenseless Pajamas.

  • amatsuki azu censoredcreampiebig titsEBODe bodyinabarEBOD-997EBOD997ebod00997
    • 2023-06-16
    210 min

    HJMO-609 Black Pantyhose OL Specialist That Is Wet Around The Outside Fixed Dildo Hips Pretending Shame Game An Obstacle Race That Gradually Grows In Size Acme In Agony! If You Can"t Reach The Goal Within The Time Limit, You"ll Be Punished Fo

  • censoredcreampieHJMOfirst planHJMO-609HJMO609hjmo00609
    • 2023-06-16
    120 min

    PRED-487 Busty Married Woman OL JULIA Who Continued To Climax In Menhera Younger Man

  • julia censoredcreampiebig titsPREDpremiumtrendy yamaguchielegancePRED-487PRED487pred00487
    • 2023-06-10
    182 min

    APAA-410 Perverted OL Hitomi Hitomi Honda Who Can"t Live Without Rich Sex Like Strings

  • honda hitomi censoredcreampieblowjobAPAAaurora project annexsword treeAPAA-410APAA410apaa00410
    • 2023-05-06
    240 min

    SABA-827 Drunk Co-Worker Taken Away Without Permission Av Shoot 01

  • censoredcreampieSABAclass s amateurtodoSABA-827SABA827saba00827
    • 2023-05-03
    72 min

    300NTK-809 [Exclusive I-Cup Busty Office Lady] [The Secret To No. 1 Sales Is Straightforward...Makura! ？ ] [The Sample Is This Glamorous Echo Body] [Small Fish That Can Be Painted Anywhere And Wet! ! ] Real Raw Erotic Style Gravure-class Beautiful Br

  • amateur censoredcreampiebig titsntkntk-809ntk809300ntk-809
    • 2023-04-22
    239 min

    NASH-880 I"m Forced To Share A Room With My Longing Female Boss On A Business Trip! Being Mischievous By Subordinates Many Times In The Middle Of The Night ... 4 Hours

  • amateur censoredcreampiebig titsNASHnadeshikoNASH-880NASH880nash00880
    • 2023-04-22
    117 min

    APNS-309 Plunge-in Sales Pillow Sales A Sales Lady Weak To Push Go Sleep And Get A Job Sayaka Megumi

  • esayaka censoredcreampiedramaAPNSaurora project annexAPNS-309APNS309apns00309
    • 2023-04-21
    176 min

    XRLE-047 Beautiful Office Lady Stalking Illegal Intrusion Devil Creampie FUCK02

  • amateur censoredcreampieXRLEreal worksXRLE-047XRLE047xrle00047
    • 2023-04-15
    127 min

    300MIUM-886 Sales Department No. 1 Popular Strongest Popular Girl"s Slacking Trip! She"s Kind, Vulnerable To Pressure, And Cute, So She"s Been Persuaded To Have Sex, And She"s Got A Huge Cock That Reaches Deep Inside Her, And She"

  • amateur censoredcreampieamateurmiummium-886mium886300mium-886
    • 2023-04-14
    124 min

    FOCS-124 Short Height 148cm Big Breasts [Rookie Office Lady] From The Night In The Shared Room When I Was Fucked By The Tricks Of My Disliked Boss... The Breeding Process Of Falling Into A Sperm Pot With Uncontrollable Pleasure Chiba Ayame

  • chiba ayame censoredcreampieFOCSabc mousouzokuFOCS-124FOCS124
    • 2023-04-14
    129 min

    BNST-062 Saffle-chan Hono - A Woman Who Will Absolutely Let You Fuck If You Meet - Hono Wakamiya

  • honoka wakamiya censoredcreampieBNSTteacher mousouzokuBNST-062BNST062bnst00062
    • 2023-03-25
    120 min

    CEMD-311 Suddenly They Kidnap A Very Normal Office Lady And Turn Her Into A Sex Guy! 2 Fujita Kozue

  • kozue fujita censoredcreampiemature womanCEMDcelebrity friendsCEMD-311CEMD311cemd00311
    • 2023-03-24
    360 min

    REXD-463 Department Nagahisa, Who Kept Voyeurizing Women'S Lockers, Left The Office And My Meat Stick “Your Pussy Soup... I Wanted To Taste It”

  • censoredcreampieREXDredgroupREXD-463REXD463rexd00463
    • 2023-03-17
    81 min

    300NTK-780 [Broadcast Accident Class De Nasty River Visit! ! ] [Aim For A Three-Digit Round Spacha! ! Attractive Echi Body] [Dero F Cup Echiechi Busty Beauty Delivers Continuous Sex…! ! ] Mysterious Erotic River Hits Spacha Continuously With Act

  • amateur censoredcreampieamateurntkntk-780ntk780300ntk-780
    • 2023-03-17
    112 min

    JMTY-065 Tadaman File 17 Mana 27 Year Old Record Of Drinking Sperm And Getting Creampied By A Convenient Sex Buddy

  • censoredcreampieamateurJMTYteacher delusion groupukyo lifeJMTY-065JMTY065jmty00065
    • 2023-02-25
    75 min

    300NTK-769 [Gachi Tide Slender Erotic Milk F Cup OL Floor Flooded P Activity! ! ] Special Erotic OP (Handjob & Masturbation Show) Is Matching With A Beautiful OL Who Sells Underwear! ! A Hand Man Named Onasapo Has A Fierce Tide Constitution ... Compl

  • amateur censoredcreampiesquirtingntkntk-769ntk769300ntk-769
    • 2023-01-30
    188 min

    300MIUM-870 [De M-san 6 Changes That Are Too Erotic! ! ] I"m Sorry I Packed Too Much! A Beautiful Office Lady Who Looks Neat And Clean, If You Open Her Pussy, She"s Super Erotic! ! I"m Going To Have A Good Time With My Mouth! ! Overdone 4

  • amateur censoredcreampieamateurmiummium-870mium870300mium-870
    • 2022-12-14
    106 min

    300NTK-806 [God Style OL Each Defeated! ! Instant Protein! ! Instant H Special Edition] [Slender Orthodox Beauty Bitch"s Full Paisen & Gal Beauty Junior OL Bitch"s Beautiful Breasts] [Both Are Discovered To Be Shaved Miracle Hairless Generati

  • olololsp censoredcreampieamateurntkntk-806ntk806300ntk-806
    • 2022-12-02
    130 min

    300NTK-799 [Nasty Beautiful Girl & Beautiful Woman"s House Only 4P! ! ] [The W Cowgirl Position Where The Slender Beautiful Body Of A New Graduate OL Who Is Too Beautiful Dances Is A Masterpiece! ! ] [Exhibition Of Echiechi Tech That Makes An Old

  • amateur censoredcreampiesquirtingntkntk-799ntk799300ntk-799



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download