nem




FC2SHKDNATRWAAASANHODVAWDBLKGVHFSDSSCAWDCHRVCESDATIDPPPDNGODSTARSCJODVENUEBODMVSD

2020-11-01
94 min

[VEC-449]The Friend Of A Wife Who Came To Yell At Her Horny Husband Whose Adultery Was Uncovered - Yuri Sasahara

  • yuri sasahara censoredcreampiemature womanVECvenusbingo tamatsukamegami venusVEC-449VEC449vec00449
    • 2020-11-19
    118 min

    [MVSD-443]Excited G-Spot: Deep Pussy Massage By Huge Dick Covered In Magic Aphrodisiac - Akari Neo

  • akari neo censoredcreampiesquirtingMVSDm s video groupamazing meatMVSD-443MVSD443mvsd00443
    • 2020-11-22
    50 min

    Pacopacomama 112220_388 Manami Ueno

  • manami ueno uncensoredcreampiebig titspacopacomama
    • 2020-11-23
    56 min

    10musume 112320_01 I played around with a married woman who came to the restaurant’s home delivery YASUDA HARUMI

  • amateur uncensored10musume
    • 2020-11-27
    241 min

    [MFCC-005]MOON F***e CHEERS Sucking Collection. vol. 5

  • censoredcreampiebig titsMFCCprestigemoon f e cheersMFCC-005MFCC005118mfcc00005
    • 2020-11-29
    115 min

    [ANX-129]Hooked On Sex The Sexual Manipulation Of A Friend

  • riona suzujo kohara kihara censoredANXsaimin kenkyuujo bekkanhypno mansaimin reijo saimin kenkyu bekkanANX-129ANX129anx00129
    • 2020-12-04
    31 min

    FC2PPV 1593596 Combo of transcendental mafera in bondage ♥ Nipple and anal torture handjob! Raw SEX finish ♥ [Review benefits available]

  • amateur uncensoredfc2
    • 2020-12-05
    360 min

    [HUNTA-901]"It's Okay, You Can Make As Many Mistakes As You Like... So Go Ahead And Practice On Us!" My 2 Big Tits Big Stepsisters Are A Bit Older Than Me, But They Gave Me The Best Cherry Boy Cherry Popping I Could Ever Imagine! My Big T

  • censoredcreampiebig titsHUNTAhuntervolvo nakanohhh groupHUNTA-901HUNTA901hunta00901
    • 2020-12-13
    132 min

    [APKH-157]She'll Entice You To Ejaculation With Her H-Cup Beautiful Big Tits And Her Filthy Body #I Sent A Message Asking For An Offline Meetup Fuck With A College Girl (A Reader Model) Using A Secret Account And She Immediately Said OK! I Shut M

  • ran shion censoredcreampiebig titsAPKHaurora project annexhaurora project anexAPKH-157APKH157apkh00157
    • 2020-12-17
    65 min

    336KNB-133 Married couple is happy! But it’s such a time, and AV appearance in pocket money! If you hit the butt and poke it, your smile and cute smile will turn into an ecstatic expression …! I will take a gonzo with this married woman fro

  • amateur censoredcreampiemarried womanknbknb-133knb133336knb-133
    • 2020-12-18
    230 min

    [PARATHD-3062]Testing If Female Masseuses At Different Business Hotels Across The Country Will Let You Fuck Them？ 4 Hour Special (2) Nagoya, Shizuoka, Nagano, Sendai, Niigata, Toyama Edition

  • censoredbig titsuniformPARATHDparadise tvPARATHD-3062PARATHD3062parathd03062
    • 2020-12-29

    FC2PPV 1624352 [Appearance / 3p] I lent money to my friend, but he didn’t return it, so I took my sister for interest.

  • amateur uncensoredfc2
    • 2021-01-09
    147 min

    [MIAA-374]I Finally Got A Girlfriend, So I Practiced Creampie Sex With My C***dhood Friend Toa Nanashima

  • toai nanami censoredcreampieschoolgirlMIAAmoodyzeveryone s porn starMIAA-374MIAA374miaa00374
    • 2021-01-10
    59 min

    1Pondo 011021_001 Braless Neighbor In The Morning: Jessica Takizawa

  • amateur uncensored1pondo
    • 2021-01-17
    29 min

    FC2PPV 1648998 For a limited time 1480 ♯ Lori JD was brought into the room and vaginal cum shot was made.

  • amateur uncensoredfc2
    • 2021-01-23
    239 min

    [MCSR-425]Sudden Surreptitious Finger-Banging! 2 - Knowingly Or Not, Two MILFs Go To A Pick-Up Bar For Liquor And Ended Up Getting Fucked 6 Pairs, 12 Mature Girls, 4 Hours

  • censoredmature womanMCSRbig morkalfinger banging naughty taromascottMCSR-425MCSR42557mcsr00425
    • 2021-02-05
    239 min

    [SOUD-025]Sensitivity Turned Up To Max! Hedonic Sex With Flat Girl With Tiny Tits Special!!

  • censoredamateurbeautiful girlSOUDprestigebest fuckingSOUD-025SOUD025118soud00025
    • 2021-02-05
    480 min

    [DRC-023]We're Going Nampa Hunting For Amateur Girls!! How Much Would It Take To Get You To Come With Me To A Love Hotel!？ 8 Hours 05

  • censoredcreampiebig titsDRCprestigedocument recordDRC-023DRC023118drc00023
    • 2021-02-06
    149 min

    [ADN-292]So Long As She's Convenient, I'll Fuck Her. Slut Loses Control And Sleeps With Her Married Boss. Kana Yume

  • kana yui censoredsquirtingsingle workADNattackersjo styleotona no dramaADN-292ADN292adn00292
    • 2021-02-12
    92 min

    [srho-035]ひなみ(20)

  • amateur censoredcreampiebig titssrhosrho-035srho035srho-035
    • 2021-02-12
    16 min

    10musume 021221_02 Secret Pussy Collection: Narumi Kawasaki

  • amateur uncensored10musume
    • 2021-02-19
    36 min

    [BTH-121]I Want To Cum On The Face Of A Girl Like That Mikako Abe

  • abe mikako censoredbeautiful girlbukkakeBTHchobitchchovicBTH-121BTH121h-1435bth00121
    • 2021-02-25
    39 min

    [GRKG-006]友達の家で、友達の寝ている横で、友達の好きな人と…。欲望剥き出しでハメまくる禁断の寝取りセックス

  • mihina azumihina mihina nagai hiroomi nagase censoredGRKGkageki chleo hakusanGRKG-006GRKG006h-1535grkg00006
    • 2021-02-26
    79 min

    230OREC-706 Mirei

  • amateur censoredcreampiebig titsorecorec-706orec706230orec-706
    • 2021-03-04
    127 min

    [KEED-066]My Girlfriend's Mom Started Luring Her Daughter's Boyfriend To Temptation With Erotic Lingerie And Creampie Sex Chitose Yura

  • chitose in the evening censoredcreampiemarried womanKEEDcenter villageshibuyahanazono center villageKEED-066KEED066h-086keed00066
    • 2021-03-26
    66 min

    230OREX-210 Yuri-san

  • amateur censoredcreampiebig titsorexorex-210orex210230orex-210
    • 2021-04-01
    72 min

    FCP-009 [Delivery only] Even though it’s a shop without shavings … Super-excessive service will blow away fatigue and sperm! !! Repeat confirmed! Squeezed men’s beauty treatment salon ＃ 2

  • amateur censoredamateurfcpfcp-009fcp009fcp-009
    • 2021-04-11
    107 min

    390JNT-019 [Cum I’m Going] I ● Put an erotic selfie on the star, pick up a G milk gal on SNS! !! Transcendental squirting constitution! !! Please burn your ears with the dirty words that pop out while you have convulsions! "It’s awesome

  • amateur censoredcreampiebig titsjntjnt-019jnt019390jnt-019
    • 2021-04-13
    60 min

    299EWDX-356 Fair-skinned plump big breasts wife has a lewd sexual desire to catch other sticks in 3 years of marriage

  • amateur censoredbig titsmarried womanewdxewdx-356ewdx356299ewdx-356
    • 2021-05-07
    62 min

    [NTTR-062]A Female Employee I Switched Bodies With Asumi Yoshioka And Now I Get To Have Al The Sex I Want In The Office! I Reverse Fucked My Own Body And Streamed It Live LOL

  • yoshioka asuka censoredcreampiebig titsNTTRsod createben katoknotriNTTR-062NTTR0621nttr00062
    • 2021-06-01
    216 min

    [KUSE-015]This Anal Virgin Is A Real-Life College Girl Who Is Getting Her First Anal Fuck While Dribbling Anal Juices And Straining Herself Through Orgasmic Pleasure Sara Kagami (21 Years Old) 3-Hole Sex A Massive Enema Consecutive A-to-M (Get Your N

  • kagami sara censoredsingle workKUSEsod createyuukanjoyuu no kuse ga sugoiKUSE-015KUSE0151kuse00015
    • 2021-06-04
    86 min

    [ETQR-243](Breaking In POV) Married Woman Wants To Get Knocked Up By A Massive Cock Karina, Age 33

  • censoredcreampiemarried womanETQRerotic timeETQR-243ETQR243etqr00243
    • 2021-06-04
    120 min

    [JUL-598]Mom's Friends - Hoka Yonekura

  • hoika yonekura censoredmature womanslutJULmadonnajyoji kawaiJUL-598JUL598jul00598
    • 2021-06-15
    32 min

    [NYH-134]On A Packed Bus I Pushed My Hard Dick Into A Big Titty Married Woman On Her Way Home From Shopping And Lifted Up Her Miniskirt To Turn Her On, Then I Fucked Her Right There And Then Yu Shinoda

  • shinoda yu censoredbig titsmarried womanNYHdirectorsdirectorsnyan nyan houseNYH-134NYH1341nyh00134
    • 2021-06-25
    120 min

    [WAAA-080]Eating Out The Best Mistress And The Best Slut Raw In This Sexual Affair - Ai Sayama

  • sayama love censoredcreampiebig titsWAAAwanz factorywanzWAAA-080WAAA080waaa00080
    • 2021-06-26
    244 min

    [MCSR-441]Forbidden Sexual Nursing Caregivers Who Enjoy Taking Care Of What's Below The Belt 10 Girls 4 Hours

  • sumika nagao sakura censoredgrandfatherMCSRbig morkalsaburo kamegashimamascottMCSR-441MCSR44157mcsr00441
    • 2021-07-21
    44 min

    527SROC-001 Ayano

  • amateur censoreduniformamateursrocsroc-001sroc001527sroc-001
    • 2021-07-21
    39 min

    527SROC-015 Mari (21)

  • amateur censoredamateursrocsroc-015sroc015527sroc-015
    • 2021-07-23
    81 min

    259LUXU-1445 Luxury TV 1434 "Occupational Pattern, I’M Excited When Seen By People …" A Pianist With Attractive Lips And Slender Legs Has Appeared! If You Are Blamed For An Embarrassing Appearance That You Do Not Usually Do, Her Che

  • amateur censoredamateurluxuluxu-1445luxu1445259luxu-1445
    • 2021-08-13
    208 min

    [HUNTB-080]She Was Bored With Normal Sex, And Wanted More Excitement, So She Decided To Take The Plunge Into Lesbian Love! But She Was Embarrassed, And Wasn"t Able To Take That Leap. So We Made A Suggestion, "It Won"t Be So Bad If A Cock

  • censoredcreampielesbianHUNTBhunterkonnyaku kannohhh groupHUNTB-080HUNTB080huntb00080
    • 2021-08-21
    69 min

    SIRO-4619 [First Shot] [Healing Boobs To Be Admired] [Obscene Body Of A Neat Nursery Teacher] A Fascinating G Milk Nursery Teacher Who Is Sure To Be Very Popular With Both Children And Adults. A Neat And Clean Beauty Disturbs Marshmallow Beautiful Br

  • amateur censoredbig titsamateursirosiro-4619siro4619siro-4619
    • 2021-10-02
    135 min

    [GMEM-045]Female Detective Gets Captured By A Crime Group She"s Pursuing, Episode 5: Crazy Pussy Awakening, Starring Aya Shiomi

  • aya shiomi censoredbdsmsingle workGMEMavsbaba za babiiavscollector s goldGMEM-045GMEM045gmem00045
    • 2021-10-08
    149 min

    [JUL-731]I Was Adrift, At The Whims Of Her Sweet Whisperings, Trapped In A Nest Of Sexual Pleasures With A Married Woman, Until I Had To Repeat Another Year Of College ... Kana Mito

  • kana mito censoredmature womansingle workJULmadonnakimura hiroyukiJUL-731JUL731jul00731
    • 2021-10-08
    18 min

    FC2PPV 2313523 500 Yen! 2 Shots Of Semen Cum Swallowing Without Blowjob! A Girl Who Will Do Her Best In Ng Play If You Ask ♪ Dedicated Play With A Smile Even If You Are Not Good At It! Iroha-Chan Chapter 3 _ Bonus

  • amateur uncensoredfc2
    • 2021-10-17
    67 min

    300NTK-648 [F Cup Erotic Breasts Married Woman] [Intrinsic De Nasty Echona] [Other Stick Nn Fetish] Severe De Nasty Beauty Has A Hot Spring Stealth Sex Date With A Saffle Man! !! Of Course, A Rubberless Vaginal Cum Shot Mast! !! A Brood Parasite, Etc

  • amateur censoredcreampiebig titsntkntk-648ntk648300ntk-648
    • 2021-10-22
    176 min

    [MISM-218]Her Deep Throat Is Hungry Her Long-Awaited Oral Subjugation This Shy Girl Is Showing Off Her Maso Style With A Smile I"m Going To Do My Best To Do A Deep Throat Blowjob! Yukina-chan

  • censoredbeautiful girldeepthroatMISMemumusume labMISM-218MISM218mism00218
    • 2021-10-23
    240 min

    [EYS-070]Picking Up Gals And Taking Them Home Highlights, Old Man Fucking! 12 Tsundere Specially Selected Women Make You Crazy 4 Hours

  • censoredcreampieamateurEYSstudio i sEYS-070EYS070eys00070
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download