nanpa japan




FC2MEYDNGODKSBJDTTFSDSSHDKAONEZNNPJAUKSAWDGMEMMIDVCHRVSANDASDPPPDHMNWANZHNDJUFE

2020-10-23
57 min

FC2PPV 1544381 [First Press Limited 1980] [S-class Libido ②] Astonishing Sexual Battle ❤️ Real Succubus VS Rinko Sentai 5 Ranger 6P ❤️ Rare Cannon Creampie 7 Shots & Rare Cannon Facial Cumshot 1 Shot ❤️ 8 Shots Sperm Spark ❤️

  • amateur uncensoredfc2
    • 2020-11-02
    64 min

    [KBTV-037]Will A Girl Who Believes In Horoscopes Fall For Our Fake Fortune Teller？ How Easy Is It To Get Laid If You Tell Her It's Fate？ We Find Out

  • censoredamateurKBTVmessy tvKBTV-037KBTV037h-1514kbtv00037
    • 2020-11-02
    52 min

    FC2PPV 1555510 [Personal shooting] A mature wife who wants to be embraced by a man even in her 40s.

  • amateur uncensoredfc2
    • 2020-11-02
    61 min

    FC2PPV 1555507 Limited to 3 days [Individual shooting] Prefectural general course ③ Gal who goes to school by bicycle ・ Creampie while staying slowly

  • amateur uncensoredfc2
    • 2020-11-22
    119 min

    [CAWD-151]Osaka LOVERS "I'll Let You Forget Me..." She Is Nice Like A Kitten, Kind, Simple, But She Completely Bares Her Emotions During Sex... She Took Up Residence In My Heart, I Was Madly In Love. Mitsuha Higuchi

  • mitsuha higuchi mai yahiro censoredcreampiebeautiful girlCAWDkawaiimichiru arashiyamaCAWD-151CAWD151cawd00151
    • 2020-11-22
    130 min

    [CAWD-148]Double Shaved Pussy Squirting Wetting Yourself Huge Orgasm Special Ichika Matsumoto Yui Nagase

  • ichika matsumoto yui nagase censoredsquirtingbeautiful girlCAWDkawaiimonchanCAWD-148CAWD148cawd00148
    • 2020-11-23
    73 min

    259LUXU-1339 Luxury TV 1330 A small devilish nurse who seduces patients is back! The body dominated by unfulfilled desires becomes a sensitive constitution that feels just by being gently touched by a man. Swing your hips with your instinct fully ope

  • amateur censoredbig titsamateurluxuluxu-1339luxu1339259luxu-1339
    • 2020-12-10
    122 min

    [FSDSS-134]Extreme Close-Ups Of Her Perfect Hot Ass In Satisfying Sex Of All Sorts Sora Amakawa

  • tenkawa sora censoredbig titssingle workFSDSSfalenotonkatsufaleno starFSDSS-134FSDSS1341fsdss00134
    • 2020-12-16
    60 min

    Caribbeancom 121620-001 My mom and I seduced the virgin boy Maki Koizumi, Mirai Hanamori

  • maki koizumi uncensoredcreampiehandjobcaribbeancom
    • 2020-12-31
    136 min

    [JUL-429]I Want To Be Madam's Bike Saddle - Old Man Saddle Thief Goes After Married Woman With Nice Ass - Nao Shinguji

  • jinguji temple nao censoredmature womansingle workJULmadonnamametaro mamezawaJUL-429JUL429jul00429
    • 2020-12-31
    64 min

    [SIROR-043]The Work Of A Mature Woman For Rent - The Secret Side Of A Wife That Her Husband Will Never See - FILE NO.43

  • censoredcreampiebig titsSIRORdispatched.comSIROR-043SIROR043h-1492siror00043
    • 2021-01-02
    55 min

    FC2PPV 1629807 041 [3P Special Oma ● Kotoo ○ Chi (PTM)] A blow semen beam from a big orgy with daughters of anything

  • amateur uncensoredfc2
    • 2021-01-06
    481 min

    [YVG-024]21 Girls Get Horny For Real While Showing Off Their Panties And Cum Like Crazy! All-POV Underwear Masturbation Challenge!

  • censoredslutYVGglory questYVG-024YVG02413yvg00024
    • 2021-01-09
    40 min

    275OCHA-079 Arisa

  • amateur censoredschoolgirlamateurochaocha-079ocha079275ocha-079
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-17
    114 min

    [VAGU-236]For My Beloved Husband... I Became A Doll - Beautiful Mannequin Wife Side Story - Natsuki Takeuchi

  • natsuki takeuchi censoredcreampiemarried womanVAGUvenuskanyeultimaVAGU-236VAGU236vagu00236
    • 2021-01-20
    240 min

    [MGDN-145]A Mature Auntie With A Ripe Body's Massage Shop, 240 Min.

  • rei higuchi yoshinori yoshino censoredmature womanMGDNstar paradisemegadonMGDN-145MGDN145h-254mgdn00145
    • 2021-01-22
    103 min

    [YSN-537]I'm A Crazy Girl - Satomi Arakane

  • satomi censoredanalcreampieYSNnonYSN-537YSN537h-127ysn00537
    • 2021-01-31
    21 min

    FC2PPV 1667267 [Immediately delete the body] JD with a boyfriend who works part-time. I tried vaginal cum shot without telling my boyfriend

  • amateur uncensoredfc2
    • 2021-02-04
    90 min

    [MESU-082]I Asked For The Number One Bubble Princess At A High Class Bathhouse, And To My Surprise, Out Came This Old Lady!？ But 2 Hours Later, I Was Sucked Dry To The Bone... This Is What It Means To Experience The Legendary Fully Ripe Creampie Bath

  • yumiko sakura censoredcreampiemature womanMESUcenter villageshibuyared snowMESU-082MESU082h-086mesu00082
    • 2021-02-06
    143 min

    [NGOD-143]Please Promote My Husband... In Return, I'll Let You Touch My Tits... Chitose Yuki

  • chitose in the evening censoredmature womansingle workNGODjet eizomanji groupNGOD-143NGOD143ngod00143
    • 2021-02-11
    124 min

    [NSM-028]An Aphrodisiac Oil Massage Peeping & Creampie Fucking With Amateur Girls VOL.28 We Used This Compound Of Super Powerful Aphrodisiacs Mixed Into Massage Oil And Used It On These Unsuspecting Ladies, And They Were Surprised To Find Their Bo

  • gloss hall shiori endo bookmark satoshi yamaguchi censoredcreampieNSMnishi shinjuku massage main officeaphrodisiac massageNSM-028NSM028h-1342nsm00028
    • 2021-02-17
    71 min

    [sika-035]りお(18)

  • amateur censoredcreampieschoolgirlsikasika-035sika035sika-035
    • 2021-02-25
    40 min

    [GRMO-025]ニンゲン観察 バーでナンパされ、出会ったばかりの男と酒の勢いでワンナイトSEX

  • censoredGRMOmura chblood clam abaloneGRMO-025GRMO025h-1534grmo00025
    • 2021-03-07
    136 min

    [TSF-015]You're A Male Office Worker, But When You Wake Up In The Morning, You've Discovered That You've Become A Woman (20) A Thorough Investigation You Were Bi And Absolutely The Dominant One, But Now You're Cumming Like A Bitch And

  • ao itaba censoredcreampiebeautiful girlTSFkaguyahimept mousouzokugynecomastia reportTSF-015TSF015tsf00015
    • 2021-03-12
    52 min

    FC2PPV 1722581 [Junior-kun ⑧] A beautiful girl who is very similar to Kan Takizawa who works at a flower shop from this spring.

  • amateur uncensoredfc2
    • 2021-03-19
    102 min

    SRH-002 Miho

  • amateur censoredbig titsamateursrhsrh-002srh002srh-002
    • 2021-03-29
    49 min

    292MY-425 Goto June

  • amateur censoredbig titsmarried womanmymy-425my425292my-425
    • 2021-04-23
    124 min

    [DKD-004]Let's Both Take A Bath At Your Place Sachiko

  • sachiko censoredbig titssingle workDKDdream ticketham the mcDKD-004DKD00424dkd00004
    • 2021-05-10
    120 min

    [TENX-21041]Sex Experts With A Lifetime Of Experience Sixty Year Olds & Seventy Year Olds Version

  • censoredamateurmature womanTENXtennin xTENX-21041TENX21041h-1542tenx21041
    • 2021-05-16
    69 min

    FC2PPV 1820612 Finally SEX! !! !! Real idol-Transcendence premiere-

  • amateur uncensoredfc2
    • 2021-05-18
    63 min

    FC2PPV 1824407 A figure that should not be seen by women with gorgeous occupations. First shot SEX with vaginal cum shot.

  • amateur uncensoredfc2
    • 2021-06-16
    125 min

    [ROYD-057]Repeat Business Guaranteed! This Super Cute Fresh Face Massage Parlor Girl Won't Let You Touch Her, But She Immediately Let Me Rub Her Pussy, And She Was Just Too Easy! Even After She Came, My Endless Piston-Pounding Thrusts Kept Cummin

  • asahina nanase censoredcreampiebeautiful girlROYDroyalmorikihhh groupROYD-057ROYD057royd00057
    • 2021-07-17
    119 min

    [NNPJ-462]A Tokyo Halo Girl. Fucking A Girl in an Overwhelmingly Cute Uniform. Beautiful Girl With a Cute Animal Personality & Perfect Grade Blowjob 3 Raw Blasts Suzu-chan

  • censoredcreampieuniformNNPJnanpa japanNNPJ-462NNPJ462nnpj00462
    • 2021-07-27
    71 min

    300NTK-612 [Namaiki Kansai Beauty Gal Kimo Uncle Ji ○ Seeded Pleasure Fell! !! ] Fucking Cheeky P Activity Expedition Gal Negotiations & Netinechi Uncle Tech And Pleasure Fell From Disgust In The Direction Of Pleasure! !! The Temptation To Insert

  • amateur censoredcreampieamateurntkntk-612ntk612300ntk-612
    • 2021-07-31
    125 min

    [DNJR-055]"I Support Your Coming!" A Home-Delivery Supporter of Jacking Off. Mizuki Yayoi.

  • mizuki yayoi censoredbig titsslutDNJRinu mousozokumaboroshi koDNJR-055DNJR055dnjr00055
    • 2021-08-06
    220 min

    [ROOM-026]Hotties Willingly Accept Sexual Domination

  • censoredcreampiebdsmROOMhomeroom delusion groupROOM-026ROOM026room00026
    • 2021-09-03
    119 min

    483SGK-039 [Super Breasts H Cup] [5 Barrages] [Endless Ikuiku Climax] [Small Devil That Ruins A Man] [College Student Overdeveloped] Shakes! Shake! Powerful H Milk! Bombing Tremor 3d! Powerful Huge Breasts Comparable To VR! Dynamic Climax To Dynamic

  • amateur censoredamateursgksgk-039sgk039483sgk-039
    • 2021-09-09
    80 min

    168HRS-012 Chitose 2

  • amateur censoredcreampiebig titshrshrs-012hrs012168hrs-012
    • 2021-09-14
    68 min

    499NDH-028 [Urgent Coverage] Affair Creampie Sex In Exchange For Rewards! Married Woman Immerse In The Host Club Without Telling Her Husband [Translation Ali Debt Wife Case 4]

  • amateur censoredcreampiebig titsndhndh-028ndh028499ndh-028
    • 2021-09-17
    131 min

    [JUFE-327]The Return!! A 1-Year Anniversary The Cum Swallowing Ban Has Been Lifted A 10-Cum-Shots-In-A-Row 127-Minute Non-Stop Sex Filming Session Rena Momozono

  • reina taoyuan censoredbig titssingle workJUFEfitchkirinJUFE-327JUFE327jufe00327
    • 2021-09-18
    97 min

    500DPL-0036 Former Kindergarten Teacher CAR Sex Haru Shiina

  • amateur censoredamateurdpldpl-0036dpl0036500dpl-0036
    • 2021-09-18
    102 min

    390JAC-114 [Superb Style X Tall 169 Cm X 4 Raw Squirrels] Angel’S Smile And Melody! I’ve Seen Such A Cute Girl! ？？ Sensitive Body Is Squirming Tide Every Time It Pokes! Creampie At The Small Devil’s Explosive Erotic Cowgirl! !! It Feel

  • amateur censoredcreampieamateurjacjac-114jac114390jac-114
    • 2021-09-22
    74 min

    533NNS-007 White Gal Beauty Birthday Festival! !! Creampie Continuous Inevitable Plump Beauty Huge Breasts! !! Shaking Gal Milk Umee Ww Sperm Beauty Man Leaked Video With Continuous Shooting! !! Masturbation Too Much Alarm WW

  • amateur censoredcreampiebig titsnnsnns-007nns007533nns-007
    • 2021-09-23
    125 min

    [SPRD-1462]Surrogate Mother Yuri Honma

  • really censoredcreampiemature womanSPRDtakara eizousumineko sanpeialeddinSPRD-1462SPRD146218sprd01462
    • 2021-09-24
    118 min

    [JYMA-014]This Bride Is Going On An Infidelity Spree With Her Husband"s Boss And Co-Workers A Beautiful Maso Bitch Married Woman With Big Tits And A Meaty Body Ready For Cuckold Fucking She Got Her Huge Tits Tweaked Until She Came Like The Maso H

  • tachibana mary censoredcreampiebig titsJYMAtsukuzuku onna wa tsurai yobuddha dgroupJYMA-014JYMA014jyma00014
    • 2021-09-24
    36 min

    FC2PPV 2241687 980 Yen! [Exclusive Video Without 4k] 3 Consecutive 4P Vaginal Cum Shot! Fair-Skinned Plump H Cup Huge Breasts Ol Chihiro-Chan Chapter 21 _ Bonus

  • amateur uncensoredfc2
    • 2021-10-08
    230 min

    [HUNTB-114]"I Love Big Bouncies!" Shota-kun"s Lewd Prank - Mina Kitano

  • censoredcreampieHUNTBhunterkonnyaku kannohhh groupHUNTB-114HUNTB114huntb00114



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download