nampa javcensored big tits high vision housewife




FC2WANZGMEMSHKDATIDNGODVEMAROYDSSISDASDDTTAMBIBLKPPPDSTARSMILKSANCAWDNACRSQTEAUKS

2021-01-12
38 min

H0930 ki210112 Kaho Tokita 25years old

  • amateur uncensoredh0930
    • 2021-01-13
    38 min

    230ORE-739 Mona

  • amateur censoredcreampieschoolgirloreore-739ore739ore-739
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-16
    195 min

    [STARS-339]This Girl Is A Wolf (A Horny Slut) In Sheep's Clothing (She's Pretending To Be Neat And Clean)! An SODstar Kaede Hiiragi Her Adult Video Debut

  • hiiragi kaede censoredbeautiful girlsingle workSTARSsod createanzosod starSTARS-339STARS3391stars00339
    • 2021-02-18
    151 min

    [JJBK-040]MILFs Only - Hidden Camera Voyeur Footage Of Mature Sluts Taken Home To Fuck - Then Sold As Porn 38 - Cougar Thirsty For Young Cock Moans As She Gets Plowed Edition - Ms Sachiko, G-Cup, Age 40, 5Ɗ", Sexy Tanned Nympho, Ms Toshimi,

  • censoredmature womanJJBKjukujo bank emmanuellemanji groupJJBK-040JJBK040jjbk00040
    • 2021-02-21
    58 min

    HEYZO 2466 Pervert Girl Cums With Pee – Mayumi Ninomiya

  • amateur uncensoredcreampieheyzo
    • 2021-02-21
    144 min

    [JUL-478]I Lost My Comppany And My Wife. The President's Wife Cuckold Maki Tomoda

  • maki tomoda censoredbig titsmature womanJULmadonnajo styleJUL-478JUL478jul00478
    • 2021-02-22
    116 min

    [ANZD-066]Her First Sugar Daddy Hunt - A Maso And Secretly Horny Intellectual Babe, Miku-chan (J-Cup Titties) -

  • censoredcreampiebig titsANZDapricotANZD-066ANZD066anzd00066
    • 2021-02-25
    107 min

    [SPRD-1381]So Much Better Than My Husband's... - Hitomi Hitachi

  • hitachi hitomi censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1381SPRD138118sprd01381
    • 2021-02-26
    186 min

    [DOCP-277]"Hey Big Stepbrother, Your Dick Gets Up Pretty Early In The Morning" Her Big Stepbrother Was A Late Sleeper, But His Morning Wood Was Up Early, And That Got Her So Excited, She Decided To Get A Little Taste! A Little-Stepsister-Blow

  • kawamura haru moe hazuki censoredbeautiful girlsisterDOCPprestigedocDOCP-277DOCP277118docp00277
    • 2021-03-14
    60 min

    HEYZO 2479 Having Lovely Time With A Busty, Big Booty Married Woman – Fumina Tomaru

  • fumina tomaru uncensoredcreampieheyzo
    • 2021-03-18
    70 min

    200GANA-2441 Seriously Nampa, first shot. 1610 "Ride on a man’s love counseling that is too big and shaken ♪" A female college student who got in Ikebukuro is (deceived) verified by body ♪ Missionary position, standing back, sitting posi

  • amateur censoredamateurganagana-2441gana2441200gana-2441
    • 2021-03-20

    FC2PPV 1734592 Personal shooting Miya "Video of raw vaginal cum shot with 22 years old"

  • amateur uncensoredfc2
    • 2021-03-21
    82 min

    300MAAN-636 [4 shots that sperm does not stop with G cup beautiful huge breasts that are too erotic] No bra huge breasts gal and one night SEX party ♪ Horoyo and erotic mode increase! !! With the boasting plump G cup boobs as a weapon, a series of am

  • amateur censoredcreampiebig titsmaanmaan-636maan636300maan-636
    • 2021-04-06
    481 min

    [MUCH-126]Plumped Up Labia - Chubby Shaved Pussy Girls 10 Continuous Fucks 8 Hours, 2 Discs

  • misaki hinata fumaru tomaru censoredbig titsMUCHmothermuchi mutchiMUCH-126MUCH126h-796much00126
    • 2021-04-29
    125 min

    [JRZE-044]Entering The Biz at 50! Naomi Arimori

  • naomi arimori censoredcreampiemature womanJRZEcenter villageminami daichishoku ureJRZE-044JRZE044h-086jrze00044
    • 2021-05-07
    50 min

    Caribbeancom 050721-001 3 vaginal cum shots to yukata beauty Emi Aoi

  • emi aoi uncensoredcreampiehandjobcaribbeancom
    • 2021-05-07
    93 min

    [OKS-111]Maika Hizumi Wet And Shiny And Tight A Goddess In A Competitive Swimsuit Enjoy A Cute Girl In A School Swimsuit To Your Heart's Content! Watch Her Change In Peeping Videos, And Check Out Her Tiny Titties, Big Tits, And Shaved Pussy Fun,

  • maika hizumi censoredschoolgirlbeautiful girlOKSdaddy s private photosgoddess in a school swimsuitOKS-111OKS1111oks00111
    • 2021-05-07
    150 min

    [MEYD-677]A Son's Wife Just Can't Resist Her Father-In-Law's Seduction - She Acts Like She Doesn't Want It, But She Keeps Cumming For More Yu Shinoda

  • shinoda yu censoredcreampiesingle workMEYDtameike goroMEYD-677MEYD677meyd00677
    • 2021-05-11
    64 min

    Caribbeancom 051121-001 Sex practice with my sister-in-law who wants to work in luxury spa Rino Sakuragi

  • rino sakuragi uncensoredcreampiecaribbeancom
    • 2021-05-15
    161 min

    [CMV-154]Smart-Looking Female Teacher Frequents An S&M Massage Parlor

  • niwa sumire rin hitomi censoredslutCMVcinemagicmarukatsuvixenCMV-154CMV154cmv00154
    • 2021-05-16
    35 min

    248DDG-730 Take a picture of me Yui

  • amateur censoredsquirtingamateurddgddg-730ddg730248ddg-730
    • 2021-05-21
    119 min

    [NNPJ-447]I Seduced This Super Cute Gal Who Wanted To Be Popular On Social Media So I Seduced Her By Saying, "I Know A Great Spot For Taking Photos!" And That Got Her Super Excited, And Then We Went With The Flow, And I Fucked Her, And I'

  • censoredcreampieamateurNNPJnanpa japanNNPJ-447NNPJ447nnpj00447
    • 2021-06-04
    76 min

    230OREC-776 Miyu-san

  • amateur censoredmarried womanamateurorecorec-776orec776230orec-776
    • 2021-06-19
    180 min

    [JUL-611]No: A Beautiful Woman With Thorns Yes: A Married Woman With Gaps - Sakuraka Mizuki 28 Years Old AV Debut!!

  • sakuraka mizuki censoredmarried womanmature womanJULmadonnakannana dynanaJUL-611JUL611jul00611
    • 2021-06-26
    64 min

    H0930 ki210627 Takai Junko 37years old

  • amateur uncensoredh0930
    • 2021-07-30
    148 min

    [JUL-676]I Met My Teacher Again As A Callgirl -Ai Mukai

  • ai mukai censoredmature womansingle workJULmadonnakitorune kawaguchiJUL-676JUL676jul00676
    • 2021-08-02
    126 min

    FC2PPV 1952142 3Q Legend ♥ ️ A Few Years After The Shocking Virginity Loss Video … A Transparent Fair-Skinned Slender Beautiful Nude ♥ ️ Innocent Beauty Pussy With A Hymen Still ♥ ️ Urgent Release Of An Unreleased New Motion Picture Left By That

  • amateur uncensoredfc2
    • 2021-08-13
    81 min

    300MAAN-682 [F Cup X Beautiful Legs X Medical College Student] "Miku-San"’S Request For Marunage! Self-Proclaimed Circle Crusher! ？？ Sperm Mania Of Orgy Hope! !! Yodare Juice Dakudaku Sweat Dripping The Tide And Never Ending The Cowgirl

  • amateur censoredcreampiesquirtingmaanmaan-682maan682300maan-682
    • 2021-08-21
    120 min

    [NEWM-010]Forbidden Sex With The Bride"s Mother 2: My Mother-in-law Is So Much Better Than My Wife... Shihori Akiyama

  • akiyama shiori censoredmature womanmomNEWMglobal media entertainmentnakano yayoinewmomNEWM-010NEWM010newm00010
    • 2021-08-31
    45 min

    292MY-478 Yuki Rie 2

  • amateur censoredcreampiebig titsmymy-478my478292my-478
    • 2021-09-07
    139 min

    [STARS-447]クラスで一番人気Nさんの乳首責め求愛ささやき淫語で身も心もかき乱されまくり 夏目響

  • natsume hibiki censoredschoolgirlbeautiful girlSTARSsod createkyouseisod starSTARS-447STARS4471stars00447
    • 2021-09-11
    240 min

    [CADV-825]My Favorite Girlfriend Sachiko

  • sachiko censoredcreampieCADVcrystal picturecrystal exCADV-825CADV825cadv00825
    • 2021-10-08
    120 min

    [BANK-057]Coed Hot Spring Girls: Horny Girls With Big Tits Who Love Bathing With The Boys" Cocks And Balls Within Reach

  • censoredcreampieuniformBANKma ko ginkoutakechanBANK-057BANK057h-1495bank00057
    • 2021-10-13
    42 min

    229SCUTE-1137 Kono wa (Narumi Konowa)

  • amateur censoredbig titsamateurscutescute-1137scute1137229scute-1137
    • 2021-10-16
    171 min

    [SORA-340]Wild Partying Exhibitionist! Pissing Exposure When She Lets Loose After Chugging A Few! Cum Swallowing Right Outside! This Super Horny Party Girl Squeezes Out 5 Full Cum Loads With Her Slutty Instinct! Ends With A Non-stop Round Of Fucking

  • miho tsuno censoredslutsingle workSORAyama to soradenchuuSORA-340SORA340sora00340
    • 2021-10-22
    133 min

    [JUL-748]A Madonna Label Exclusive No.2 Infinite Orgasms!! This Tall, Mainstream, Beautiful Married Woman Is Tasting What Pleasure Is Like Over On The Other Side Her First And Greatest Follow-Up Fuck Yuka Aota

  • yuka aota censoredmature womansingle workJULmadonnamamezawa mametarouJUL-748JUL748jul00748
    • 2021-10-22
    121 min

    [HMN-070]Looking Like Someone Else At First. This AV Actress Looks Kind Of Like My Girlfriend... An All-day Date Turns To Jealousy And A Whirlwind Of Overconfidence That Ends In A Serious Creampie Load. Aoi Kururgi

  • aoi kururugi censoredcreampiebeautiful girlHMNhonnakatanaka baconHMN-070HMN070hmn00070
    • 2021-10-24
    59 min

    523DHT-0294 Black Hair, Long, Lazy And Bright E-Cup Big Breasts Beautiful Witch Wife Shoko 35 Years Old

  • amateur censoredbig titsmarried womandhtdht-0294dht0294523dht-0294
    • 2021-10-30
    22 min

    FC2PPV 2389903 [Dangerous Guy] Masturbation So As Not To Get Caught During An Important Remote Interview At The University

  • amateur uncensoredfc2
    • 2021-11-02
    53 min

    188HINT-0485 Teruyo

  • amateur censoredcreampiemarried womanhinthint-0485hint0485188hint-0485
    • 2021-11-05
    151 min

    [SSIS-229]Miharu Usa Is In A 24-Hour Orgasmic State Of Amazing Pleasure With A Lifetime"s Worth Of Fucking As Her Lewd Nipples Shiver While She Gives It Her All For Wild And Intense Sex.

  • miharu hanasaki censoredbig titsbeautiful girlSSISs1 no 1 stylemonSSIS-229SSIS229ssis00229
    • 2021-11-05
    31 min

    FC2PPV 2404260 Appearance! !! Limited Number! [Uncensored] Cum Shot & Vaginal Cum Shot To A Nasty Busty Beauty Wearing A Sweet Perfume Scent And A Lewd Scent! !!

  • amateur uncensoredfc2
    • 2021-11-06
    121 min

    [MDTM-745]Complete POV Sailor Prostituting. I Love My Teacher Nana Hayami

  • don t be quick censoredcreampieuniformMDTMk m producetodouchuu kikakuMDTM-745MDTM745mdtm00745
    • 2021-11-19
    58 min

    483SGK-054 [Almost An Angel. ] [Small Devil With A Cute Face] [Snow Skin] [Perfect Body With Pink Nipples] [Face Deviation Value 75 Ginza Hostess] [Anime Voice With Ears] Cute! Too Cute! Almost An Angel Advent! A Little Devil Who Has A Cute Face And

  • amateur censoredamateursgksgk-054sgk054483sgk-054
    • 2021-12-24
    123 min

    [DFE-057]I Am Eating Up This Y********l. Rena Usami

  • reina usami censoredcreampieuniformDFEwaap entertainmentnishiki sasafearlessDFE-057DFE0572dfe00057
    • 2021-12-25
    69 min

    C0930 tk0049 Hiroko Hayashizaki 30years Old

  • amateur uncensoredc0930
    • 2022-01-22
    57 min

    C0930 ki220123 Shinobu Mikami 21years old

  • amateur uncensoredc0930



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download