mxdlp




FC2AMBINATRJUFEATIDSTARSVEMADTTHMNDASDMEYDCHRVMILKRBDMARAHNDMIDECAWDCESDSQTEONEZ

2020-11-30
47 min

FC2PPV 1589847 ☆ First shot ☆ Complete appearance ☆ Outstanding style ♥ Neat and clean 20-year-old beautiful breasts JD is the first Gonzo and ascension is very satisfying with a series of calls “It feels good ♥ Feels good ♥” SEX ♥ [With be

  • amateur uncensoredfc2
    • 2020-12-12
    45 min

    FC2PPV 1588940 [Personal shooting] Rika 20-year-old female college student Refre Miss ★ I made a neat JD wear super lewd underwear and made a vaginal cum shot!

  • amateur uncensoredfc2
    • 2020-12-12
    51 min

    [tkwa-145]めい

  • amateur censoreduniformschoolgirltkwatkwa-145tkwa145tkwa-145
    • 2020-12-18
    310 min

    [YMSR-031]She Competed In The Track-And-Field Inter-College Championships In The 2000s - Now She's Ready For Hardcore Anal Action - MIP Hot Booty Babe - Athlete With Two Gaping Holes

  • censoredYMSRmountain and sky delusion groupsuperb.comboYMSR-031YMSR031ymsr00031
    • 2020-12-20
    125 min

    [ARM-935]Pile-Drivin' Piston Cowgirl 5

  • sakaegawa noa aya mamiya censoredslutARMaroma planningmania satoshiaromaARM-935ARM935arm00935
    • 2020-12-21
    111 min

    [HERY-108]Turn A Guy's Daughter Into A Complete Bitch 6 - Himena Takahashi

  • takahashi himena censoredcreampiesingle workHERYyellow mousouzokudr fuyellowHERY-108HERY108hery00108
    • 2020-12-25
    71 min

    326EVA-157 Tall legs tattoo BODY! !! Is she an angel or a devil with wings on her back？ A cool and mysterious beauty cums! Creampie in a supermodel-class gal’s shaved vagina! !! [Girls Nampa]

  • amateur censoredcreampieamateurevaeva-157eva157326eva-157
    • 2020-12-27
    54 min

    C0930 ki201231 Kazue Ichihashi 54years old

  • amateur uncensoredc0930
    • 2021-01-08
    301 min

    [EQ-539]Search: Erotic Curly Haired Girl

  • censoredbig titsamateurEQbullittfetish specialtyEQ-539EQ539h-100eq00539
    • 2021-01-12

    C0930 ki210112 Mitsuko Fuchida 42years old

  • amateur uncensoredc0930
    • 2021-01-14
    62 min

    230OREC-667 Shiori 5

  • amateur censoredcreampieamateurorecorec-667orec667orec-667
    • 2021-01-15
    58 min

    374SHOW-040 NENE

  • amateur censoredamateurshowshow-040show040374show-040
    • 2021-01-15
    331 min

    [YNPS-001]Quickly Picking Up Beautiful Bitches: Summer Pool Edition

  • censoredsquirtingbeautiful girlYNPSpetersnampaYNPS-001YNPS001h-021ynps00001
    • 2021-01-22
    153 min

    [PXH-019]This Girl Answered Our Ad # 003 # Sa-chan (20 Years Old) # From Miyazaki # Divine I-Cup Titties # She Loves To Be Spanked # A Colossal Tits Freelancer # She Cums When Choked # An Explosively Prematurely Cumming Babe

  • censoredcreampiebig titsPXHprestigeprestige hmjmPXH-019PXH019118pxh00019
    • 2021-01-31
    483 min

    [JUJU-264]They've Got Tiny Tits, But Their Rock Hard Nipples Will Get You Hard, Too! Slender, Beautiful, Mature Babes With Delicious Flat Chests Cum Hard For Creampie Sex 40 Girls, 8 Hours

  • censoredcreampiemature womanJUJUjukujo japanJUJU-264JUJU264juju00264
    • 2021-02-05
    76 min

    [PLY-001]She Wanted To Become A Truly Famous Sexy Actress ... So Now She's Making Her Anal Debut! Yukiho Shirase

  • yukiho shirase censoredsingle workPLYplay entertainmentkaji shun wareplayPLY-001PLY001h-1557ply00001
    • 2021-02-12
    119 min

    [JUFE-257]Dense Licking Sexual Intercourse, Dripping Juices While Staring At A Man - Karen Usui

  • usui ren censoredsquirtingblowjobJUFEfitchJUFE-257JUFE257jufe00257
    • 2021-02-17
    240 min

    [YVG-026]Perverted Slut Loves Licking Public Toilet Seats

  • censoredslutYVGgloryYVG-026YVG02613yvg00026
    • 2021-02-19
    66 min

    [OTIM-056](For Streaming Editions) (Daydream POV Fantasies) I'm Getting Hyped With My Favorite Colleague At Work Sara Kagami

  • kagami sara censoredcreampieuniformOTIMprestigeonetimeOTIM-056OTIM056118otim00056
    • 2021-02-22
    64 min

    SIRO-4389 [First shot] [Fair-skinned Sunrender JD] [Number of cums XX times] An active female college student with a cute smile. She is ashamed but feels sensitive body, but she is scared many times .. Application amateur, first AV shooting 196

  • amateur censoredsquirtingamateursirosiro-4389siro4389siro-4389
    • 2021-03-08
    14 min

    FC2PPV 1717185 A video of a bright bitch that makes you feel insanely fun and touches with swimsuit and loose socks

  • amateur uncensoredfc2
    • 2021-03-13
    119 min

    [MEYD-662]The Married Woman Next Door Complained Every Day About The Noises From My TV, Because I Liked To Watch Adult Videos, But I Complained Right Back And Told Her, "Well I Can Hear You Masturbating All The Time Too!" And When This Horny

  • emi fukada aika censoredcreampieblowjobMEYDtameike gororyo inugamiMEYD-662MEYD662meyd00662
    • 2021-03-17
    49 min

    FC2PPV 1730047 Meychan’s latest work! !! I won’t lose to my sister! I tried to reverse Nan, but tears. Tears. Creampie etch from! !!

  • amateur uncensoredfc2
    • 2021-03-21
    119 min

    [NNPJ-437]My Lover Trashed Our Engagement ... *So Now I'm On A Rampage And Looking For A Sugar Daddy! With Every Cock Thrust, I'm Letting Go Of My Loneliness ... A Piston-Pumping Barely Legal Is Begging You To Soothe Her Broken Heart (The The

  • censoredcreampieblowjobNNPJnanpa japanNNPJ-437NNPJ437nnpj00437
    • 2021-03-21
    120 min

    [JUL-516]NGR - Go With The Flow - My Wife Was Fucked And Discovered The Pleasures Of Orgasming For The First Time Maki Tomoda

  • maki tomoda censoredmature womansingle workJULmadonnajotaro tomiJUL-516JUL516jul00516
    • 2021-04-01
    135 min

    [JRZE-039]Married Woman In Her Fifties Shoots Porn For The First Time! Akiko Izumi

  • ryoko izumi censoredcreampiemature womanJRZEcenter villagejiro fukagawajurakuJRZE-039JRZE039h-086jrze00039
    • 2021-04-05
    376 min

    [DANUHD-002]The Mysterious Princess With A Shaved Pussy: Nadia 18 Years Old AV Debut + 1 Work

  • nadia censoredbeautiful girlsingle workDANUHDdandydandyuhdDANUHD-002DANUHD0021danuhd00002
    • 2021-04-09
    42 min

    FC2PPV 1761757 Infiltrate a secret orgy ㉙ The girl who is going to participate is slapstick on the day (> _ <) That child comes up like a savior in front of the disappointed Osans! 10 consecutive vaginal cum shots! !! * High-quality version &

  • amateur uncensoredfc2
    • 2021-04-16
    67 min

    [tkwa-167]ひすい

  • amateur censoredcreampieschoolgirltkwatkwa-167tkwa167tkwa-167
    • 2021-04-30
    64 min

    SIRO-4510 [First shot] [Fresh E cup x pre-buttocks] [Sorrowful anime voice] A stoic beautiful girl who goes to the gym while attending a dance vocational school and is eager to polish herself. She plays a cute cry when she is tampered with sensitive

  • amateur censoredamateursirosiro-4510siro4510siro-4510
    • 2021-05-01
    119 min

    [RBK-013]Widow's Tragic Suffering - Dripping Wax, Trembling Whips, Moaning Orgasms Of Sorrow Aya Shiomi

  • aya shiomi censoredsingle workRBKattackersyu mabukiryupakuRBK-013RBK013rbk00013
    • 2021-05-01
    233 min

    [ZMAR-041]Complete! Chisato Shoda 2

  • shota chisato censoredbig titsmature womanZMARplanet plusthe whole damn thingZMAR-041ZMAR041h-237zmar00041
    • 2021-05-07
    112 min

    [RCTD-400]A Strategy To Influence Women In Mourning!？ A Pretty Beauty Turns Into A Dark, Filthy And Vulgar Woman In Mourning!？

  • miko shion suzuka walnut censoredslutRCTDrocketroute yamazakiRCTD-400RCTD4001rctd00400
    • 2021-05-20
    117 min

    [RCTD-402]Daydream Item: Ultimate Evolution Series Fascinating Teleworking Man

  • ayano kato yamamoto renka censoredslutRCTDrockettaro kanbeRCTD-402RCTD4021rctd00402
    • 2021-05-29
    92 min

    [SOAV-077]A Married Woman's Desire For Infidelity - Honoka Tsujii

  • tsujii honoka censoredbig titssingle workSOAVhitozuma engokai emmanuelleihyo kairoiSOAV-077SOAV077soav00077
    • 2021-06-15
    181 min

    [SDNM-285]Struggling Mother Who Takes Care Of The Housework And C***dcare No Matter How Busy She Gets Kanna Sawamura 24 Years Old Porn Debut

  • kanna sawamura censoredsquirtingsingle workSDNMsod createsuisei akaigenuine married woman the porn experienSDNM-285SDNM2851sdnm00285
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-23
    32 min

    FC2PPV 1883004 First shot! !! Limited number [Uncensored] "Teacher … I’m not really such a child." The lonely feelings and back face of a beautiful girl. Second-year vaginal cum shot to the undisputed honor student! !! (Feature film

  • amateur uncensoredfc2
    • 2021-07-27
    99 min

    [MDVHJ-035]The Indecent Sex Life Of An Older Man Living In A Widow's C***dren's Room - Rieko Hiraoka

  • rieko hiraoka censoredmature womansingle workMDVHJgraffiti japanmovieMDVHJ-035MDVHJ03548mdvhj00035
    • 2021-08-06
    117 min

    [MEYD-696]I Went To A Health Spa (No Happy Endings Allowed) And Caught The Arrogant Married Woman Next Door Working There. I Told Her I"d Spill Her Secret If She Didn"t Let Me Creampie Her! Kokona Asakura

  • asakura here censoredcreampiesingle workMEYDtameike gorooomura daiMEYD-696MEYD696meyd00696
    • 2021-08-07
    127 min

    [MOPT-010]The Great M Fetish Brothel Where They Keep Making You Hold Your Orgasm. Ichika Kasagi

  • kasagi ichika censoredanalslutMOPTm o paradisemo tightMOPT-010MOPT010mopt00010
    • 2021-08-20
    230 min

    [HNDS-071]Why Not Fuck Us Until Morning! A Crazy Night Of Creampie Sluts!! Squirting, Swallowing, Anal, Female Orgasm, Pee, Anything Goes At This Harlem Fuck Party Full Of Nonstop Cumshots !! Mao Hamasaki Kaho Imai Yuri Fukada Azusa Misaki Mitsuki Mi

  • hamazaki mao natsuho imai censoredcreampieslutHNDSbooknanzaki masakiHNDS-071HNDS071hnds00071
    • 2021-08-24
    55 min

    516CHIN-010 [Crossdresser] Pleasure Ahead Of Pain. The First Anal Opening Is Released To The Public

  • amateur censoredanalamateurchinchin-010chin010516chin-010
    • 2021-09-03
    127 min

    [JJCC-007]A Married Woman Overflows With Nectar, JJCC- 007

  • censoredcreampiemature womanJJCCjuku onna japan emmanuellejuku onna japanJJCC-007JJCC007jjcc00007
    • 2021-09-11
    241 min

    [UMSO-414]The Y Balance Sex Of A Soft-bodied Beauty!

  • riko kitagawa ririka censoredcreampiebig titsUMSOk m produceumanamiUMSO-414UMSO414umso00414
    • 2021-09-18
    149 min

    [DPMX-017]Celebitch! Fully Clothed Temptation - Ayaba Isshiki

  • isshiki ayaba censoredsingle workDPMXavsdopamixavscollectorsDPMX-017DPMX017dpmx00017
    • 2021-09-18
    148 min

    [MYBA-038]A Married Woman"s Blooming - Ai Hiraoka

  • ai hiraoka censoredmature womansingle workMYBAhitodzumaengokai emanuelkiiroi hyouMYBA-038MYBA038myba00038
    • 2021-09-24
    117 min

    [DASD-920]Anal Sex With A Father-In-Law Whom I Hate To Death...The Foreign Wife Who Gets It Up Her Asshole. June Lovejoy

  • june lovejoy censoredanalcreampieDASDdassabasuhori nakaDASD-920DASD920dasd00920



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download