much 143




FC2JULSDABKBIWANZNACRCJODAUKGADNSSISPPPDDASDSTARSSPRDAWDDASDMIDVNACXCAWDSSNIHODV

2021-01-21
43 min

FC2PPV 1654047 [First shot] Imadoki JD ♥♥ who is curious and loves H Pien rushes in a rainy day happening …

  • amateur uncensoredfc2
    • 2021-01-24
    60 min

    Caribbeancom 012421-001 Ryu Enami, Honoka Orihara

  • ryu enami uncensoredcreampielesbiancaribbeancom
    • 2021-02-06
    31 min

    FC2PPV 1675445 Limited to 3 days [Individual] Beautiful wife of a spender. She can not repay and is taken to the room and vaginal cum shot in her raw vagina

  • amateur uncensoredfc2
    • 2021-02-12
    147 min

    [GNAB-047]JKs Who Wear Black Stockings Only! When We Told These Ladies That They Would Win Big Cash Money Prizes If They Could Identify The Remote Control That Was Controlling The Remote-Controlled Vibrator Tickling Their Pussies ...

  • censoredschoolgirlGNABprestigebang prestigeGNAB-047GNAB047118gnab00047
    • 2021-02-20
    55 min

    Caribbeancom 022021-001 Soapland With Young Girl Only, 10 Minori Koike

  • minori koike uncensoredcreampiehandjobcaribbeancom
    • 2021-03-11
    125 min

    [NHDTB-500]This Aggressor Suddenly Plunged His Rock Hard Cock Into Her Anal Hole, And At First She Started To Scream, But Then It Began To Feel So Good That This Lady With A Beautiful Ass Was Anally Cumming Like A Bitch 2

  • censoredNHDTBnatural highlemon heart nakajimaNHDTB-500NHDTB5001nhdtb00500
    • 2021-03-21
    139 min

    [JUL-512]One Box Of Condom's Worth Of Sex H

  • marika kobayashi censoredmature womansingle workJULmadonnasatsugu koyamaJUL-512JUL512jul00512
    • 2021-03-26
    125 min

    374IMGN-007 Ranran-chan

  • amateur censoredamateurbeautiful girlimgnimgn-007imgn007374imgn-007
    • 2021-04-03
    127 min

    [SORA-305]"Look At My Shameful Body" Perverted Masochistic Slut Is Open For Business! Momo Hazuki

  • hazuki peach censoredsingle workSORAyama to soratrippyySORA-305SORA305sora00305
    • 2021-04-07
    62 min

    422ION-0065 A new wife who can not have children in the middle is a vaginal cum shot SEX to a cheating partner

  • amateur censoredcreampiemarried womanionion-0065ion0065422ion-0065
    • 2021-04-16
    61 min

    [tkwa-169]あゆみ＆るい

  • amateur censoredcreampieschoolgirltkwatkwa-169tkwa169tkwa-169
    • 2021-04-19
    43 min

    475SKCK-029 Churin 2

  • amateur censoredanalamateurskckskck-029skck029475skck-029
    • 2021-04-21
    101 min

    300MIUM-690 [F milk 3 ejaculation vaginal cum shot] From the morning, it adheres to the walking libido OL called sensitivity MAX! Playing with a ruthless molester cum shot & big tits on a moving train without thinking of the knit big tits just inv

  • amateur censoredcreampiebig titsmiummium-690mium690300mium-690
    • 2021-04-22
    89 min

    229SCUTE-1109 Nono (24) S-Cute S-class beautiful girl Hanikami H

  • amateur censoredcreampieamateurscutescute-1109scute1109229scute-1109
    • 2021-04-27
    61 min

    499NDH-014 [Gal signboard girl in Shinjuku underground bar. ] Perfect body underground bar gal clerk persuaded and cum shot SEX! Although it looks flashy, the contents are clever and the gap difference is erotic! Spread your proud legs and poke them

  • amateur censoredcreampieamateurndhndh-014ndh014499ndh-014
    • 2021-05-07

    FC2PPV 1805576 Limited number [Uncensored] Plenty of vaginal cum shot on the sensitive body of a G cup slope girl! (Part 1)

  • amateur uncensoredfc2
    • 2021-05-22
    136 min

    [CEMD-012]First Lesbian Unleashed! Aya Shoimi Gets Lesbian Training From Rena Aoi

  • aya shiomi blue censoredlesbianmature womanCEMDceleb no tomoCEMD-012CEMD012cemd00012
    • 2021-06-04
    118 min

    [ATID-466]BBP Female Detective Falls In Love With Big Black Penis Kaho Imai

  • natsuho imai censoredsingle workATIDattackerseitaro hagaein madATID-466ATID466atid00466
    • 2021-06-05
    61 min

    Caribbeancom 060521-001 Look At Me having SEX! and Jerk Off On My Face! 4 Saori Miyazawa

  • saori miyazawa uncensoredcreampiebukkakecaribbeancom
    • 2021-06-10
    95 min

    [ZEAA-062]My Masochistic Sex Friend Is A Tall, Plump Married Woman - Aoi Aoyama

  • aoyama censoredbig titsmarried womanZEAAcenter villagesky cloudsthe pole center villageZEAA-062ZEAA062h-086zeaa00062
    • 2021-06-24
    120 min

    [DLDSS-014]A Married Woman With Big Tits Fucks Her Father-In-Law While Her Husband Is In Hospital - She Falls For His Kisses And His Aphrodisiacs - Riho Agatsuma

  • riho gazuma censoredbig titssingle workDLDSSdahliaebiDLDSS-014DLDSS0141dldss00014
    • 2021-07-10
    239 min

    [NASH-538]The Beautiful Hostess Who Succeeded in Attracting Customers With Her Rich Hospitality Using a Membership Plan of Having Sex With Female Customers During the Night While on Hot Spring Vacations. A Treasure Map in Western Japan.

  • censoredmature womanNASHnadeshikoNASH-538NASH538nash00538
    • 2021-07-10
    127 min

    [KYMI-013]Pin-Up Slut

  • hamazaki mao suzuki mayu censoredslutKYMImiluaida yumenoKYMI-013KYMI013kymi00013
    • 2021-07-16
    55 min

    FC2PPV 1926027 [Appearance] Dated With A 140 Cm Active Concafe Lady. Her Uncle Plays With Her Little Body And Cums Continuously

  • amateur uncensoredfc2
    • 2021-07-17
    179 min

    [JUL-655]Temptation of a Mother in Law who Wants her Son in Law's Dick so Much She Can't Stand It Asahi Mizuno

  • mizuno chaoyang censoredmature womanslutJULmadonnakogoro kindaichiJUL-655JUL655jul00655
    • 2021-07-23
    56 min

    FC2PPV 1936648 [Individual Shooting 47] Two People’S Appearance 20-Year-Old Streak Pie Bread And 3p Finally Cleaning Fellatio Firmly From Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2021-07-24
    240 min

    [HUSR-240]The Country With The Most Beautiful Women In The World! Special Collection Of The Ultimate Weapons From Russia, The Kingdom Of Beauties! Who Ever Knew Russia Had Such Amazing Women？!

  • isabel clark ibana censoredcreampiebig titsHUSRbig mocalbooker thustleHUSR-240HUSR24057husr00240
    • 2021-08-07
    125 min

    [REAL-774]"I"m Going To Send You Straight Down To Sweet Hell" A Sweetly Sadistic Beautiful Girl Is Explosively Sucking Out Boys" Semen Until They Go Insane! Endless Insanity And Sweet And Squishy Pussy-Pounding Sex! Hana Shirato

  • white peach censoredcreampieblowjobREALk m producesamoarireal real worksREAL-774REAL774real00774
    • 2021-08-10
    61 min

    Pacopacomama 081021_513 Mature Lady Piledriver Position BJ : Chisato Nishiyama

  • amateur uncensoredpacopacomama
    • 2021-08-27

    FC2PPV 2089807 [Feast] A Fair-Skinned Slender Dog-Loving Beauty. I Made It My Favorite Dog And Kept It.

  • amateur uncensoredfc2
    • 2021-08-29
    43 min

    292MY-456 Nanako Yada 2

  • amateur censoredcreampiebig titsmymy-456my456292my-456
    • 2021-09-09
    121 min

    [GUN-758]I Want To Lick Their Toes Until Its All Wrinkley! VI Running Shoes Edition

  • misaki azusa marina saito censoredbukkakeGUNradixmg yukkypreeminentGUN-758GUN758433gun00758
    • 2021-09-17
    115 min

    FC2PPV 2077268 [Personal Shooting] Slender Beautiful Wife With Outstanding Style Hatsune-San Subjective / Objective Set

  • amateur uncensoredfc2
    • 2021-10-08
    123 min

    [IPX-744]I Love My Fiancee, But It Turns Out That His Older Brother Was A Relentless Stalker Who Kept On Fucking Me Back In The Day Kana Momonogi

  • kana momonogi censoredbeautiful girldeepthroatIPXidea pocketdoragon nishikawatissueIPX-744IPX744ipx00744
    • 2021-10-21
    72 min

    10musume 102121_01 Massuse Scammer Persuades The Innocent Girl To Have Sex That Sex Is An Outstanding Effect For Losing Weight Mei Nozomi

  • amateur uncensored10musume
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-04
    65 min

    413INST-180 [Youth Orgy] ♂ ♀ 4 People Adolescent Bunny With Pleasure Oil Nipples Erected, Intense Acme Convulsions Iki Can Not Stop! A Friend Cums In Front Of Her Boyfriend W (Rena Aoi Mai Yahiro)

  • amateur censoredcreampieschoolgirlinstinst-180inst180413inst-180
    • 2021-11-12
    57 min

    230OREC-939 Lala (Lara Kudo)

  • amateur censoredcreampieuniformorecorec-939orec939230orec-939
    • 2021-11-20
    61 min

    1Pondo 112021_001 The Throbbing: My Girlfriend Loves Giving Me a Head Early in the Morning Remi Fuyutsuki

  • amateur uncensored1pondo
    • 2021-11-29
    64 min

    SIRO-4712 [First Shot] [Innocent Whitening Skin] [Curious Precocious Musume] Introductory Glasses Girl With Only One Experienced Person Appears. The Actor’s Egg Chasing A Dream Exposes His Instinct In Front Of The Camera .. AV Application On The

  • amateur censoredamateursirosiro-4712siro4712siro-4712
    • 2021-12-10
    136 min

    [JUL-799]Happen To Meet Sexually Harassing Teacher From College Days When Working As Call Girl From That Day Made To be Sex Processing Pet. Runa Tsukino

  • tsukino luna censoredmature womansingle workJULmadonnashiro shotenJUL-799JUL799jul00799
    • 2021-12-25
    138 min

    [DBER-135]Lewd Hound Club. Sacrificial Teasing. Beautiful Girl"s Cum Hell- Part 9: Sad Prey Convlused by Burning Shame And Nectar. Nana Maeno

  • nana maeno censoredschoolgirlbdsmDBERbabyentertainmentkikubonred babeDBER-135DBER135dber00135
    • 2022-01-10
    25 min

    FC2PPV 2583880 Prefectural Ordinary Course ③ One Super Sensitive Masterpiece In A Thousand Years Beautiful Girl With Beautiful Legs, Black Strike Molester, Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2022-01-15
    66 min

    SIRO-4764 [First Shot] [Bowl-Shaped Beauty Big Tits] [Awakening Of Ubu Daughter] A Beautiful Girl With The Most Cute And Inexperienced Appearance Who Is Shy While Smiling. When Her Cock Is Inserted, She Changes To A Reaction Like Another Person, And

  • amateur censoredbig titsamateursirosiro-4764siro4764siro-4764
    • 2022-01-21
    128 min

    [MISM-229]Beautiful College Girl Responds To Our Ad And Is Subjected To Deep Throating Hell! Throat Breaking Debut Ami-chan

  • censoredbeautiful girldeepthroatMISMm girls labinaballMISM-229MISM229mism00229
    • 2022-01-27
    138 min

    [SPRD-1508]Keeping It A Secret From My Husband, I Asked My Father-In-Law To Get Me Pregnant. Kana Morisawa.

  • kana morisawa kanako iioka censoredmature womansingle workSPRDtakara eizohotate ikkanaleddinSPRD-1508SPRD150818sprd01508
    • 2022-01-29
    48 min

    FC2PPV 2632733 Nipple Crusher Appears! (Laughs) My Nipples Are So Sucking That They Turn Red ♥ S Kid Beauty’s Rich Nipple Blame ♪ In Return I Did A Lot Of Vaginal Cum Shot! * High-Quality Version & Review Benefits Included ♪ [Personal Shootin

  • amateur uncensoredfc2
    • 2022-02-01
    97 min

    [YMDS-078]Lewd And Vulnerable Girl Invites A Company Rep Over Her House And Gets A Creampie Load In No Time. Manami Oura

  • manami oura censoredcreampieblowjobYMDSmomotaro video publishingasakusa is jiroYMDS-078YMDS078ymds00078



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download