momotaro eizo




FC2LULUJUFEMEYDAWDMIDVATIDGMEMFSDSSSHKDWANZAPODRBDWAAANACXNACRCHRVSANAUKGHMNBBAN

2021-01-01
102 min

[MBRAA-187]大矢あいみ 制服SCANDAL

  • ooya aimi censoredsoloworkMBRAAspice visualMBRAA-187MBRAA187
    • 2021-01-08
    131 min

    [DTT-072]A Married Woman Life Insurance Sales Lady Who Will Accept Any Sexual Demand From Her Customer In Order To Make A Sale Megu Sugizaki 31 Years Old Her Adult Video Debut She's Got Light Skin And A Voluptuous Body And She'll Lure You To

  • meg sugisaki censoredbig titsmature womanDTTprestigeitoman akifumikanbiDTT-072DTT072118dtt00072
    • 2021-01-09
    150 min

    [FFFS-024]Taking Mature Women Home! Married Women Playing With Other Guys' Cocks 21 - Tall Women With Beautiful I-Cup Tits Get Off On A Younger Guy's Dick! - Ayako-san, I-Cup, 40yo, 176cm Tall, Takes The Lead- Masumi-san, I-Cup, 45yo, 180cm T

  • censoredmature womanslutFFFSmature woman private videos emmanuellemanji groupFFFS-024FFFS024fffs00024
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-28
    97 min

    [HIMA-091]My Lovely Mother Gets Remarried - Yuri Tadokoro

  • yuri tadokoro censoredcreampiemarried womanHIMAcenter villageshibuyahanazono center villageHIMA-091HIMA091h-086hima00091
    • 2021-02-01
    302 min

    [DMOW-215]Dirty Talk Teacher And Male Subs - Complete BEST Collection 5 Hours Ichika Kamihata Asahi Mizuno Yuri Nikaido

  • ichika kamihata mizuno chaoyang censoredslutDMOWoffice k smowDMOW-215DMOW21536dmow00215
    • 2021-02-12
    120 min

    [BANK-029]Creampie In The Open Air Hot Springs: Pretty Light-Skinned Girl From Northern Japan! Silently Slutty With Big Sexy Areolas And A Shaved Pussy

  • censoredmature womanBANKpussy banktake chanBANK-029BANK029h-1495bank00029
    • 2021-02-12
    159 min

    [MDBK-160]Submissive Guys Only: Dirty Talking Reflexologist Enveloping Your Entire Body In Pleasure With Detox Oil

  • kimi and ayumi sarina kurokawa censoredcreampieMDBKbazookak taroMDBK-160MDBK160h-1496mdbk00160
    • 2021-02-18
    240 min

    [HUNTA-955]My Parents Hired A Private Tutor For Me, And Her Big Tits Are Way Too Big, And She's Just Too Sexy For Me To Handle! She's Always Wearing Outfits That Show Off Her Cleavage, And I Can't Concentrate On My Studies, Thinking About

  • censoredcreampiebig titsHUNTAhunterkawajirihhh groupHUNTA-955HUNTA955hunta00955
    • 2021-02-18
    119 min

    [ROYD-044]You Can Blow Your Load In Me In Return! I Bumped Into A Beautiful Y********l In Uniform Who Ran Away From Home And She Wants To Stay At My Place Ten Hasumi

  • hasumiten censoreduniformbeautiful girlROYDroyalcognac kaminohhh groupROYD-044ROYD044royd00044
    • 2021-03-03
    120 min

    [PFES-024]Adult Hookup App That Lets You Meet Up With Horny Rich Women And Fuck Them The Same Day!

  • censoredcreampiebig titsPFESnanpa japansummer panties festivalPFES-024PFES024pfes00024
    • 2021-03-19
    47 min

    FC2PPV 1671733 [Personal shooting] Appearance / Miya 20 years old / I’ve been doing all-you-can-eat, raw squirrel, and vaginal cum shot to a fair-skinned girl with big dicks! !!

  • amateur uncensoredfc2
    • 2021-03-27
    117 min

    [XVSR-586]

  • rumi tadami censoredcreampiebig titsXVSRmax aikuzo yoshidacalenXVSR-586XVSR586xvsr00586
    • 2021-03-28
    75 min

    300NTK-543 Fallen ○ Po addiction! ？？ Exposed walk with a perverted beauty ♪ Do perverted by herself! !! Breathtakingly beautiful beauty bitch BODY & de nasty SOUL! !! It’s crazy with continuous insertion of big dicks in the coveted nice ass!

  • amateur censoredcreampieamateurntkntk-543ntk543300ntk-543
    • 2021-04-09
    149 min

    [IPX-643]Sacrificial Slut - Confined For 10 Days To Take Endless Loads From Older Guys With Huge Cocks Kana Momonogi

  • kana momonogi censoredsquirtingsingle workIPXidea pocketdishIPX-643IPX643ipx00643
    • 2021-04-22
    68 min

    435MFC-100 [Black Gal x Beautiful Legs Open Legs = Superb View] The Proportional Reiwa Gal and Raw Saddle 2nd Round! Contrary to her flashy appearance, the naughty things are surprisingly passive! ？？ I’m blaming and blaming in a position that ma

  • amateur censoredcreampiebig titsmfcmfc-100mfc100435mfc-100
    • 2021-04-22
    29 min

    FC2PPV 1782413 * Resale until weekend [Individual] Please see after understanding.

  • amateur uncensoredfc2
    • 2021-05-08
    243 min

    [UMSO-391]Secret Affair With Middle Aged Men POV Footage Of 10 Married Women Enjoying Fucking Around vol. 02

  • riho fujimori saori yagami censoredmarried womanmature womanUMSOkm produceumanamiUMSO-391UMSO391umso00391
    • 2021-05-08
    67 min

    200GANA-2486 Seriously Nampa, first shot. 1633 Picking Up Big Tits Girls Who Are Interested In Cosplay! Bring it to the studio and start shooting cosplay! Sensitive Mako who is super sensitive is ahegao ream that rolls up again and again! !!

  • amateur censoredbig titssquirtingganagana-2486gana2486200gana-2486
    • 2021-05-18
    135 min

    [SDMM-090]One-Way Mirror Cab - Ayaka Mochizuki X Yuri Honma - Could You Resist These Sex Goddesses？ These Natural Sluts Try To Score With You In This Reverse Pick Up Special! Hung College S*****t Gets Ravished Edition

  • ayaka mochizuki really censoredcreampiesquirtingSDMMsod createzampamagic mirrorSDMM-090SDMM0901sdmm00090
    • 2021-05-20
    180 min

    [FUFU-200]When I Let My Serious Fifty-Something Wife Party With My Young Employee And Left Them Alone...180 Minutes

  • censoredamateurmature womanFUFUstar paradisefufuFUFU-200FUFU200h-254fufu00200
    • 2021-05-22
    47 min

    H4610 ki210522 Chikako Hamano

  • amateur uncensoredh4610
    • 2021-06-08
    119 min

    [ARM-985]Girls Spread Their Pussies And Assholes! Beautiful Young Dirty Talking Girl

  • tsubaki rika mitsuha higuchi censoredslutARMaroma planningkijin kasaiaromaARM-985ARM985arm00985
    • 2021-06-20
    132 min

    [FLAV-272]The Legendary Idol Girl From School Is A Devilish Slut With Huge Tits Who Likes To Seduce Older Men Hana Himesaki

  • himesaki hana censoredschoolgirlslutFLAVdigital arkdigital ark digital arkFLAV-272FLAV272flav00272
    • 2021-06-25
    45 min

    FC2PPV 1887907 [Uncensored] G-cup busty beauty esthetician Ami-chan has a vaginal cum shot copulation !!: Esthetician: Ami-chan (24 years old)

  • amateur uncensoredfc2
    • 2021-07-04
    94 min

    300MAAN-671 [Demon Libido J ● Bitch x Super Class 4 Ejaculation] Super Beautiful Slender Body & Beautiful Small Butt God Erotic STYLE! Yariman girls who look and feel perfect ● Raw! Immerse yourself in the recently learned Feratech & nipple tor

  • amateur censoredcreampieamateurmaanmaan-671maan671300maan-671
    • 2021-07-17
    43 min

    FC2PPV 1925049 [Personal Shooting] ♀ 201 Female College Student Mi ◯ -Chan 19 Years Old 9th Time A Beautiful Girl Jd Who Is Cohabiting At Home While Her Boyfriend Is Away And Is Ntr Seeded With Other Stick Sperm!

  • amateur uncensoredfc2
    • 2021-08-22
    54 min

    SIRO-4598 [First Shot] [Active Beautiful Girl JD] [Unstoppable Saddle Tide] A Beautiful Girl JD With A Feminine Delicate And Supple Body Has Appeared. Beginner Musume Who Had Experience Only With A Favorite Person Exposes A Foolery In Front Of The Ca

  • amateur censoredamateurbeautiful girlsirosiro-4598siro4598siro-4598
    • 2021-09-09
    82 min

    [IENF-164]"Is It Bad That My First-time Partner Is Lewd Like Me？" You"re A Cherry Boy If You Confess Your Feelings For An Exceptionally Lewd Classmate？ Let"s Give It A Shot First! Her Naive Demeanor Is A Change From Normal, But It Mak

  • himari ayase niko nekomura censoredcreampieslutIENFienergytiger kosakaiienfIENF-164IENF1641ienf00164
    • 2021-09-14
    32 min

    C0930 ki210914 Eriko Ikegami 24years old

  • amateur uncensoredc0930
    • 2021-09-21
    83 min

    200GANA-2562 Seriously Nampa, First Shot. 1693 She Is A Slender Beauty Who Gradually Begins To Feel When She Touches Her Body As A Massage, And She Is Swept Away And Has Sex. Just By Caressing, You Can Feel It While Getting It Wet And Shy! (Ran Utase

  • amateur censoredbig titsamateurganagana-2562gana2562200gana-2562
    • 2021-09-24
    80 min

    [PITV-027]Yochino Ichinose Pure Girl -Famous Scout Competition Finalist Makes Is A Former Entertainer But Makes Shocking Erotic Debut-

  • ichinose yo nanano censoredbeautiful girlsingle workPITVpistilPITV-027PITV0275581pitv00027
    • 2021-09-25
    240 min

    [JKSR-511]It"s 10 a.m. Why Aren"t You At School... Tragic Pleasure Experienced By 5 Barely Legal Babes 4 Hours 2

  • chiharu sakurai hill erina censoredcreampieuniformJKSRbigmorkalpinkjunkyJKSR-511JKSR51157jksr00511
    • 2021-10-01
    120 min

    [WAAA-103]Titty Fuck For A Girl In A Reverse Bunny Suit. She Made Me Ejaculate Like Crazy In Hell. JULIA

  • julia censoredcreampiebig titsWAAAwanz factoryWAAA-103WAAA103waaa00103
    • 2021-10-08
    117 min

    [JUL-742]That Hot Female Employee Is Making Her Debut On The Madonna Label!! Rough Sex NTR With My Neighbor A Horny Dude Who Lives In A Trash-Filled Home Is Impregnating This Housewife With Cuckold Sex Kana Sasaki

  • natsuna sasaki censoredcreampiemature womanJULmadonnamishima rokusaburoJUL-742JUL742jul00742
    • 2021-10-13
    120 min

    [268SPYE-275]整体師淫行マッサージスペシャル 6

  • amateur censoreduniformamateurspyespye-275spye275268spye-275
    • 2021-11-13
    86 min

    355OPCYN-199 Lala (Lara Kudo)

  • amateur censoredcreampieamateuropcynopcyn-199opcyn199355opcyn-199
    • 2021-11-19
    95 min

    277DCV-194 Is It Okay To Send It Home？ Case.188 Beautiful "Supreme Standing Back" [8 Heads, G Cup, Waist 56 Cm, Ultimate Beauty Body, Sp] ⇒ Tears On Your Nasty Face … No Problem In The Neighborhood! Full Throttle 100 Iki Crazy ⇒ I Want T

  • amateur censoredbig titsamateurdcvdcv-194dcv194277dcv-194
    • 2021-12-09
    49 min

    229SCUTE-1145 Madoka (23) S-Cute Unfussy Uniform Big Breasts Girl Creampie H (Madoka Shizuki)

  • amateur censoredcreampiebig titsscutescute-1145scute1145229scute-1145
    • 2021-12-10
    244 min

    [HUNTB-155]I"m Timid And Can"t Even Say No To My Female Classmate That Wants To Come Over And Watch An AV... Then She Starts Feeling Lewd While Watching The AV And Can"t Stop Feeling Around My Crotch.

  • censoredcreampieschoolgirlHUNTBhunterborubo nakanohhh groupHUNTB-155HUNTB155huntb00155
    • 2021-12-17
    45 min

    FC2PPV 2522099 First Shot! !! Limited Number! [Uncensored] Creampie Twice To A Gorgeous Active Beauty College Student Gcup Beauty With High Pride! !! (Feature Film)

  • amateur uncensoredfc2
    • 2021-12-23
    64 min

    SIRO-4736 [First Shot] [Beauty With Glossy Hair] [Fair-Skinned Beautiful Breasts] Discovered A Shy Nude Model With Shallow Erotic Experience. While Cramping The Plump Nice Ass To The Advance Of Tsuyoshi, I Get Drunk With The Pleasure That I Have Not

  • amateur censoredamateursirosiro-4736siro4736siro-4736
    • 2022-01-06
    51 min

    FC2PPV 2574551 The Ending Of A Girl Chasing A Dream. I’ll Expose It To You.

  • amateur uncensoredfc2
    • 2022-01-14
    65 min

    564BMYB-002 Amateur Big Tits Female Teacher Ayaka

  • amateur censoredcreampiebig titsbmybbmyb-002bmyb002564bmyb-002
    • 2022-01-14
    39 min

    FC2PPV 2590676 First Shot! !! Limited Number! [Uncensored] A Beautiful Girl With High Pride In A High-Flying Car Is Drowning In Pleasure And Transforming Into An Obedient Girl … Creampie In A Nasty Superb Slender Body! !! (Bonus / Face-Up Blow C

  • amateur uncensoredfc2
    • 2022-01-22
    206 min

    [JKSR-526](Leaked Videos) A Sch**lgirl Home Shame Sex The Night Is Far Too Dark, For This Clan That Chooses To Ignore All Taboos A Stepfather And Stepdaughter A Stepbrother And His Little Stepsister Etc. Forbidden Fucks 3 Clans

  • censoredamateurJKSRbig morkalobockeyprink junkyJKSR-526JKSR52657jksr00526
    • 2022-01-29
    240 min

    [YVG-037]My Family Is Nearby, So I Cannot Utter A Sound! Quiet But Intense Immoral SEX

  • kimishima mio shinoda yu censoredslutYVGglory questYVG-037YVG037yvg00037
    • 2022-02-10
    175 min

    [FSDSS-361]The Girl Who Exposes Herself Nude On Her Secret Social Media Account Just Might Be Amatsuka-san From Next-door... Horny, Attention-seeking Gorgeous Office Lady Meets Up Locally For Sex, Enjoying Cum Loads Every Day. Moe Amatsuka

  • angel moe censoredslutsingle workFSDSSfalenoichimon maetafaleno starFSDSS-361FSDSS3611fsdss00361



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download