mine




FC2VENXMVSDCJODKSBJROYDLULUABWAVSAVEMAHMNMEYDMIDEFSDSSCESDNACXSANWANZDASDONEZNGOD

2021-01-04
36 min

FC2PPV 1631676 [Personal shooting] The tongues of the three men and the meat sticks blame the wife’s erogenous zone one after another! !!

  • amateur uncensoredfc2
    • 2021-01-07
    91 min

    [FUGA-045]I Had Unforgettable, Deep And Rich Sex With My Mom's Friend Natsumi Omachi

  • natsumi omachi censoredcreampiemarried womanFUGAcenter villagesouthern earthparadise center villageFUGA-045FUGA045h-086fuga00045
    • 2021-01-09
    174 min

    [JUFE-245]POV Sex With Older Guys - Sweaty, Sticky, Passionate Fucks Caught On Camera Rena Momozono

  • reina taoyuan censoredcreampiebig titsJUFEfitchJUFE-245JUFE245jufe00245
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-15
    118 min

    [XRW-963]Targeted Anal 02

  • censoredanalXRWreal workstomimasu diranreal real worksXRW-963XRW963172xrw00963
    • 2021-01-16
    118 min

    [MVSD-452]Dual Curvaceous Devils - Twin Sluts With Huge Tits Lavish Your Dick With Attention - A Succubi Sandwich

  • yukino nagi nene tanaka censoredcreampiebig titsMVSDm s video groupMVSD-452MVSD452mvsd00452
    • 2021-01-17
    150 min

    [LZDM-036]Pretend Marriage？! Passionate Fireworks From The Start! Lesbian Couple's Secret Overnight Lovers' Trip In School Uniforms Mizuki Yayoi Hono Wakamiya

  • mizuki yayoi honoka wakamiya censoredschoolgirllesbianLZDMlesrewild sevenlezure dramaLZDM-036LZDM036lzdm00036
    • 2021-01-23
    120 min

    [MACB-021]美脚奥さんはチ●ポに飢えてる 結婚以来初めての他人棒と貪り合う濃厚セックス 弥生みづき

  • mizuki yayoi censoredsquirtingsingle workMACBsharkmedia cubeMACB-021MACB021h-687macb00021
    • 2021-01-25
    53 min

    328HMDN-331 [Amateur / 3P individual shooting] 39 years old Enjoy 3P by holding a child-bearing wife with beautiful breasts nice body to a man who met for the first time. Her heart is broken by the fact that anyone can feel it if it is a cock and her

  • amateur censoredcreampiebig titshmdnhmdn-331hmdn331328hmdn-331
    • 2021-02-05
    244 min

    [DOCP-273]"Is She An Angel!？ Or The Devil!？" This Beautiful Nurse Is Actually Super Horny! She's Sucking Up Semen With Her Tight Little Pussy And Giving Me A Cowgirl Ride And Squeezing Out All My Semen, Over And Over Again. 3

  • emily hikari sakuraba kanobuki censoredcreampieamateurDOCPprestigedoc premiumDOCP-273DOCP273118docp00273
    • 2021-02-06
    24 min

    FC2PPV 1675088 [3P Real NTR] Husband is away from work During the day, a married woman brings in two men and ejaculates on a bed sleeping with another person’s cock and a beloved husband

  • amateur uncensoredfc2
    • 2021-02-06
    151 min

    [C-2614]Married Woman Stolen Away, A Steamy Vacation 24

  • censoredCgogostakeshi karakicore gogo sC-2614C2614140c02614
    • 2021-02-20
    95 min

    [ISD-002]You Only Call Me When You're Lonely, But I Want You So Badly It Drives Me Crazy Yuri Fukada

  • censoredISDdream ticketnishiki sasaISD-002ISD002h-254isd00002
    • 2021-02-25
    43 min

    [orec-698]ひめか

  • amateur censoredcreampieamateurorecorec-698orec698orec-698
    • 2021-02-27
    191 min

    [HONB-209]Quickie With A Beautiful Gal With Big Tits BEST

  • censoredbig titsamateurHONBmercuryfirstHONB-209HONB209h-1133honb00209
    • 2021-03-06
    120 min

    [ATID-454]My Stepmother Has Become My Very Own Glory Hole, And Is Helping To Take Care Of My Sexual Needs. Hijiri Maihara

  • kiyoshi maihara censoredsingle workdramaATIDattackerskitorune kawaguchiin madATID-454ATID454atid00454
    • 2021-03-10
    40 min

    FC2PPV 1720567 Miyu 18 years old A teenage amateur I met on SNS! E-cup big breasts boobs x plump big peach butt! Creampie with seeds on a body that is too erotic and can be conceived specializing in SEX!

  • amateur uncensoredfc2
    • 2021-03-16
    142 min

    1Pondo 031621_001 Mio Futaba : Mio Futaba Special Edition

  • amateur uncensored1pondo
    • 2021-03-25
    240 min

    [SW-764]All In The Family Daydream - Special Edition. Stepson Gets Hard Over His Stepmom's Hot Bod. "We'll Keep This A Secret From Daddy" She Kindly Cradles His Cock, Then Uses It To Slake Her Lust - 15 Horny MILF SPECIAL!

  • censoredmilfSWswitchyocchanswitch switchSW-764SW7641sw00764
    • 2021-03-26
    175 min

    [ABW-071]Super See-Through Slutty Academy CLASS 10 Hot And Steamy Sex With Bodies Under See-Through Clothing For See-Through Fetishists!

  • yuki rumina censoredsquirtingcosplayABWprestigecharlie nakataabsolutely wonderfulABW-071ABW071118abw00071
    • 2021-03-29
    55 min

    492JCHA-040 Destroy JK with the first denma 2

  • amateur censoreduniformschoolgirljchajcha-040jcha040492jcha-040
    • 2021-04-03
    137 min

    [URKK-038]This Video Will Make You Cum At Least 10 Times! Sex Salon Where Breast Milk Effects Allow You To Cum Multiple Times Hinami Narusawa

  • hinami narusawa censoredcreampiebig titsURKKunfinishedwild sevena familiar breastURKK-038URKK038urkk00038
    • 2021-04-07
    135 min

    512EMST-001 Thin Miku

  • amateur censoredcreampiebig titsemstemst-001emst001512emst-001
    • 2021-04-10
    147 min

    [SINN-019]Distressing Super Masochistic Cuckholding! The Story Of How I Rented Out My Beloved Wife On A Whim And She Was Impregnated By Being Cum In Over And Over!

  • censoredcreampieSINNshinsekai mousouzokucurious adultererSINN-019SINN019sinn00019
    • 2021-04-15
    120 min

    [SYKH-024]She Cums Quick - Plump, Pale-Skinned Married Slut In Glasses - She Came To The Big City To Cheat - Hinata, Age 23

  • censoredcreampieamateurSYKHleisurely missus emmanuelleSYKH-024SYKH024sykh00024
    • 2021-04-25
    63 min

    FC2PPV 1786836 [Top secret video] [Leaked] Active H cup huge breasts gravure college days before debut Individual shooting Gonzo video leaked Creampie (leaked Gonzo data)

  • amateur uncensoredfc2
    • 2021-05-18
    82 min

    FC2PPV 1824605 Prefectural ② Grade Ace lifted-Limited quantity-

  • amateur uncensoredfc2
    • 2021-05-29
    59 min

    10musume 052921_01 Get excited with bondage cosplay Miho Saeki

  • amateur uncensored10musume
    • 2021-06-15
    81 min

    [PPMNB-108]Being Cute Is Not Enough! Natsuki

  • censoredbig titsbeautiful girlPPMNBcranePPMNB-108PPMNB108h-706ppmnb00108
    • 2021-06-15
    79 min

    [THNIB-073]Pure Love / Ayumi Kashiwagi

  • censoredbig titsbeautiful girlTHNIBcraneTHNIB-073THNIB073h-706thnib00073
    • 2021-06-20
    166 min

    [DGCEMD-022]Online Exclusive! With Special Bonus Footage - Wild Sub Porn Star Ayaka Mochizuki's First Anal Sex! Drilled In All Three Holes Until She Cums!

  • ayaka mochizuki censoredcreampiemature womanDGCEMDcelebrity friendsDGCEMD-022DGCEMD022dgcemd00022
    • 2021-06-26
    90 min

    300NTK-594 [Animal SEX 3 Consecutive Squeezing] 30 Saffle Regular Dovich GAL! !! The aim is the next-generation SEX symbol! !! Hundred battles of apt … No thousand … No! !! Man battle training sex animal woman on top posture with actor seco

  • sexsex censoredcreampieamateurntkntk-594ntk594300ntk-594
    • 2021-07-06
    60 min

    493NAEN-074 NTR! ？？ Slender JD with a boyfriend! ？？ Gonzo without rubber by pushing into the house Mitsuha Higuchi

  • amateur censoredamateurbeautiful girlnaennaen-074naen074493naen-074
    • 2021-08-19
    65 min

    FC2PPV 2043374 "Dear Sir, Mom, I’ll Save My Own Money." 144cm Sister-Based Poor Student Sakura-Chan. The Trajectory Of Tears And $ Falling As She Tries Her Best.

  • amateur uncensoredfc2
    • 2021-08-19
    31 min

    FC2PPV 2044555 [No] [Individual Shooting] [Luxury Review Privilege] Active Nursery Teacher, 25-Year-Old Married Woman Challenges Gonzo With Pocket Money ♡ Of Course Leaked!

  • amateur uncensoredfc2
    • 2021-08-20
    187 min

    [CJOD-307]Suite Room For Slutting It Up, Super Sadist Hot Sisters Call Me To A Hotel And Tie Me Up! Sandwich Me! Make Me Immobile! In 24 Hour Back To Back Cumshot Fucking... Minami Hatsukawa Kurea Hasumi Mitsuki Nagisa

  • hatsukawa minami hasumi claire censoredcreampieslutCJODbimasaki naochijo hebunCJOD-307CJOD307cjod00307
    • 2021-08-20
    150 min

    [MISM-211]Fucking The Three Masochist Holes Of Desire: Anal, Deepthroat, And Pussy Starring Ayaka Mochizuki

  • ayaka mochizuki censoredbig titsdeepthroatMISMemumusume labinnabarMISM-211MISM211mism00211
    • 2021-09-01
    67 min

    444KING-046 Nono

  • amateur censoredcreampiesquirtingkingking-046king046444king-046
    • 2021-09-04
    137 min

    [AVSA-178]SUPER FISHEYE FETISHISM Intense Excitement Of Honey Images, Sensual Big-Breasted Masochistic Bitch, Yukino Nagisa

  • yukino nagi censoredsingle workAVSAavsbuddha davscollectorsAVSA-178AVSA178avsa00178
    • 2021-09-07
    73 min

    FC2PPV 2171062 * Limited To 3 Days 2980⇒1980 ★ First Shot ☆ Peeling White Eyes And Spree ♥ Precocious De Transformation Daughter Uran 24 Years Old ☆ Wet And Wet With Big Cock Throat Squirrel ♥ Agony Screaming Intense Squirrel ♥ Dopyu Conceived Cum Sh

  • amateur uncensoredfc2
    • 2021-09-10
    36 min

    FC2PPV 2183179 Appearance! !! Limited Number! [Uncensored] A Long-Sought Reunion With A Beautiful Girl Who Happened To Meet In The City! !! Creampie In A Beautiful Body Wrapped In Clear Skin! !! (Part 2) This Is Her Last Work …

  • amateur uncensoredfc2
    • 2021-10-02
    145 min

    [MMBS-009]Self Titty Licking 4

  • inaba tsubaki rika censoredbig titsMMBSmarrionmiyamoto kojiroumarrion bestMMBS-009MMBS009mmbs00009
    • 2021-10-06
    136 min

    [GVH-295]Meet The S*****t Council Brats Who Group Fucked Their Hot Teacher And The Sexy PTA Chairwoman Honoka Kimura & Yuri Mizukawa

  • honoka kimura yuri mizukawa censoredbig titsGVHglory questhyonGVH-295GVH295gvh00295
    • 2021-10-15
    237 min

    [MIZD-252]See Her Hot Face And All The Action In Full View! Sexy Angles While Fucking Her Deep From Behind. Best Of.

  • nanasawa mia shoko takahashi censoredcreampiesquirtingMIZDmoodyzmoodyz bestMIZD-252MIZD252mizd00252
    • 2021-10-19
    65 min

    016DHT-0298 Seduce Madam On The Way Back From Italy Kaori Takamatsu

  • amateur censoredamateurmature womandhtdht-0298dht0298016dht-0298
    • 2021-10-21
    127 min

    [JRZE-081]First Time Filming in Her 60s, Sawako Matsui

  • sawako matsui censoredcreampiemarried womanJRZEcenter villageshibuyajurakuJRZE-081JRZE081h-086jrze00081
    • 2021-10-23
    236 min

    [OKAX-786]Horny Wives Masturbation Sessions - 30 Girls, 4 Hours - Vibrator And Finger Fun For Pussies And Clits - Enjoy The View Of Their Very Own Special Private Time

  • censoredOKAXk m produceoomei jirouokazuOKAX-786OKAX786okax00786
    • 2021-10-28
    65 min

    OREX-321 Sarina-san 3 (Sarina Momonaga)

  • amateur censoredcreampiebig titsorexorex-321orex321orex-321



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download