mature woman slender javcensored high vision jav




FC2HMNSSISAWDMARAPPPDAUKSFSDSSGMEMMIDVCAWDCESDAVSANACRBLKMIDEMVSDJUFEDTTNGODCJOD

2020-09-20
148 min

[URE-058]A Madonna Exclusive Airi Kijima In Her First Ripe Comic!! Original Story/Iris Art The Day Natsumi Sasaki's Womb Was Defiled With Orgasmic Pleasure

  • airi kijima censoredmature womansingle workUREmadonnakitorune kawaguchiure.comiURE-058URE058ure00058
    • 2020-09-20
    118 min

    [JUL-320]Hard And Tight Sex - An Illicit Relationship With My Father-In-Law That Started With Some Family Troubles - Shion Sato

  • sato white sound censoredbig titsmature womanJULmadonnarokusaburo mishimaJUL-320JUL320jul00320
    • 2020-09-18
    123 min

    [VEC-442]I Was Targeted By My Wife's Girlfriend And I Couldn't Refuse A Vaginal Cumshot - Yuka Mizuno

  • yuka mizuno censoredcreampiemature womanVECvenussarumegami venusVEC-442VEC442vec00442
    • 2020-09-18
    113 min

    [VENU-964]"Hold On For 10 More Minutes!" Her Raw Pussy Felt So Good, My Cherry Boy Cock Was About To Burst As I Pounded Her With Ass-Shaking Thrusts, But This Horny Mama Was Controlling My Ejaculations - We Took A One-Day Hot Spring Vacation

  • kana morisawa kanako iioka censoredcreampiemature womanVENUvenussarufakecest winntersVENU-964VENU964venu00964
    • 2020-09-05
    120 min

    [JUL-314]I Left My Lady-Loving Dad With My Pushover Wife, And Went On A 3-Day, 2-Night Business Trip... Sara Kagami

  • kagami sara censoredmature womansingle workJULmadonnamametaro mamezawaJUL-314JUL314jul00314
    • 2020-09-05
    119 min

    [JUL-309]With Only 1 Month To Go Until The End Of The World, I Decided To Fuck My Long-Lost Love From My S*****t Days Until My Husband With Whom I Spent Many Years Together... Rei Kuruki

  • satoshi kuruki censoredmature womansingle workJULmadonnamametaro mamezawaJUL-309JUL309jul00309
    • 2020-09-05
    159 min

    [JUL-303]This Late-Blooming Married Woman Is Blossoming Like Crazy A Former Stage Actress Married Woman Tsubaki Yukino 30 Years Old Her Adult Video Debut!!

  • yukino tsubaki censoredmature womansingle workJULmadonnahimu lockJUL-303JUL303jul00303
    • 2020-09-05
    119 min

    [JUL-310]My New Stepmom - My Favorite Woman Is Now My Stepmom - Yumi Sakurai

  • yumi sakurai censoredmature womansingle workJULmadonnajyoji kawaiJUL-310JUL310jul00310
    • 2020-09-05
    118 min

    [JUL-308]A Married Woman Who Broke The Rules Of Cuckold Sex - One By One, She Accumulated Crimes And Lies Against Her Husband - Maki Hojo

  • hojo asahi censoredmature womansingle workJULmadonnashiro shotenJUL-308JUL308jul00308
    • 2020-09-05
    146 min

    [JUL-301]The Year, 2020, Summer, Shocking. This Married Woman Is A Former TV Commercial Actress Hiroka Suzuno 36 Years Old Her Adult Video Debut!!

  • hiroka suzuno censoredmature womansingle workJULmadonnamametaro mamezawaJUL-301JUL301jul00301
    • 2020-09-01
    121 min

    [NACR-353]Middle-Aged Writer Keeps A Female Editor As A Pet Hijiri Maihara

  • kiyoshi maihara censoredcreampieblowjobNACRplanet pluscherry blossomshichidomeNACR-353NACR353h-237nacr00353
    • 2020-09-01
    247 min

    [ZMAR-025]Going Around! Nozomi Tanihara

  • nozomi tanihara censoredcreampiebig titsZMARplanet plusthe whole damn thingZMAR-025ZMAR025h-237zmar00025
    • 2020-08-28
    120 min

    [NEM-042]Genuine Abnormal Sex A Fifty-Something Stepmother And Her Stepson Chapter Sixteen A Stepmom Is Pleasured By Her Stepson's Thick Jellyroll Misato Shibasaki

  • misato shibasaki censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-042NEM042143nem00042
    • 2020-08-22
    117 min

    [JUL-291]I Lost My Mind After 7 Days Of Being Fucked By My Husband's Boss... Airi Kijima

  • airi kijima censoredmature womansingle workJULmadonnatakeshi kogaJUL-291JUL291jul00291
    • 2020-08-22
    119 min

    [JUL-293]Married Office Lady's Total Domain: Slender Married Woman Shamefully Does What She's Told At The Office - Natsuki Takeuchi

  • natsuki takeuchi censoredmature womansingle workJULmadonnajotaro tomiJUL-293JUL293jul00293
    • 2020-08-21
    115 min

    [PARATHD-2959]I Praised This Mature Woman Mail-Order Catalog Underwear Model To An Inch Of My Life And Got Her Feeling So Good She Was Willing To Have Sex

  • censoredamateurblowjobPARATHDparadise tvPARATHD-2959PARATHD2959parathd02959
    • 2020-08-16
    120 min

    [KSBJ-093]A Slender Wife Who Fell For The Trap Laid By Her Cuckold Fantasies-Obsessed Husband And His Little Brother Ayaka Muto

  • ayaka muto censoredblowjobmature womanKSBJksb kikaku emmanuellebito sakuraKSBJ-093KSBJ093ksbj00093
    • 2020-08-16
    102 min

    [VEC-436]Sweaty And Soaked In Lust! I Was Captured By An Escaped Convict Old Lady And Compelled To Creampie Her Yuka Mizuno

  • yuka mizuno censoredcreampiemature womanVECvenusbingo tamatsukamegami venusVEC-436VEC436vec00436
    • 2020-08-01
    117 min

    [JUL-251]The Condoms My Wife Buys Are One Size Too Big - Eimi Fukada

  • emi fukada censoredmature womansingle workJULmadonnajotaro tomiJUL-251JUL251jul00251
    • 2020-08-01
    230 min

    [ZMAR-021]She's Baring It All! Yuka Honjo

  • yuka honjo censoredcreampiemature womanZMARplanet plusthe whole damn thingZMAR-021ZMAR021h-237zmar00021
    • 2020-08-01
    119 min

    [JUL-288]My Beloved Wive Is Currently Interviewing For Her First Adulterous Sex Partner - Miho Tono

  • miho tsuno censoredmature womansingle workJULmadonnajotaro tomiJUL-288JUL288jul00288
    • 2020-07-24
    120 min

    [NEM-040]True Strange Desires Stepmom In Her 40s And Stepson No.12 Proud Masochist Stepmom Breaking In Her Stepson Shoko Ueki

  • shoko ueki censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-040NEM040143nem00040
    • 2020-07-19
    150 min

    [JUL-283]A Passing Hot Spring Resort Adultery Affair - Since You Won't Pay Any Attention To Me... I Decided To Fuck Another Man - Rin Kira

  • kira rin censoredmature womansingle workJULmadonnabieber gonzoJUL-283JUL283jul00283
    • 2020-07-04
    152 min

    [JUL-275]Tease Me ... Tease Me ... Tease Me ... Tease Me ... Dripping Wet Adultery Sex At The Moment Of Maximum Pussy Wetness Kana Mito

  • kana mito censoredmature womansingle workJULmadonnamametaro mamezawaJUL-275JUL275jul00275
    • 2020-07-04
    124 min

    [NKKD-170]This Old Couple Fulfilled Their Wish To Live In The Country ... But His Wife Got Fucked To Oblivion By The Farmers And Their Huge Cocks Aoi Mukai

  • ai mukai censoredbig titsmature womanNKKDjet eizomanji groupNKKD-170NKKD170nkkd00170
    • 2020-07-01
    249 min

    [ZMAR-019]All Out! Maki Hojo

  • hojo asahi censoredcreampiemature womanZMARplanet plusthe whole damn thingZMAR-019ZMAR019h-237zmar00019
    • 2020-06-26
    120 min

    [BLB-005]Big Black Dicks A Japanese Mature Woman Goes For A Big Black Ride This Black Visitor Was On A Homestay And Enjoying Revenge Four-Way G*******g Shameful Sex (She's Lifting Her Black Dick Ban!!) Toshiyo Kitamura

  • toshiyo kitamura censoredcreampiemature womanBLBglobal media entertainmentjiro sadogashimablack beastBLB-005BLB005143blb00005
    • 2020-06-26
    242 min

    [NASH-315]Stepmother/Stepson Fucking In The Country A Lusty Son's Cock Is Pumping His Skinny Stepmom's Pussy

  • kaho eriko matsuo censoredcreampiebig titsNASHnadeshikoNASH-315NASH315h-067nash00315
    • 2020-06-26
    120 min

    [NEM-037]Forbidden Sex With The Bride's Mother Chapter Eighteen I Like My Stepmom Better Than My Wife... Tomoka Takase

  • tomoka takase censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-037NEM037143nem00037
    • 2020-06-20
    120 min

    [JUL-257]Madonna Exclusive! An Unthinkable Infidelity Drama! - While I Was Away On Business... My Wife Got Fucked By My Dad Who She Hates... - Airi Kijima

  • airi kijima censoredmature womansingle workJULmadonnakitorune kawaguchiJUL-257JUL257jul00257
    • 2020-06-15
    94 min

    [VENU-938]Stepmom Fucks Son Two Seconds After His Dad Is Gone, Ai Mukai

  • ai mukai censoredcreampiemature womanVENUvenussarufakecest winntersVENU-938VENU938venu00938
    • 2020-06-12
    124 min

    [NATR-633]While Her Husband Watched... This Young Wife Got Fucked By Her Little Brother-In-Law Kana Morisawa

  • kana morisawa kanako iioka censoredblowjobmature womanNATRnadeshikobito sakuraNATR-633NATR633h-067natr00633
    • 2020-06-12
    243 min

    [NASH-306]The Bride's Mother, Forbidden Immoral Creampie Fuck

  • michiko uchihara yuri hoshino censoredcreampiebig titsNASHnadeshikoNASH-306NASH306h-067nash00306
    • 2020-06-06
    116 min

    [JUL-245]A Madonna Label Exclusive Rin Azuma Is Seriously Cumming!! Hard And Tight Sex - Loving Sex That Brings Two Sad People Together -

  • dongguan censoredbig titsmature womanJULmadonnarokusaburo mishimaJUL-245JUL245jul00245
    • 2020-06-06
    120 min

    [JUL-254]I'm No Longer Satisfied With My Husband's Cock, So... - My Pussy Was Reprogrammed With Creampie Sex With My Neighbor - Ayane Yuki

  • ayane yuki censoredcreampiemature womanJULmadonnakitorune kawaguchiJUL-254JUL254jul00254
    • 2020-06-06
    169 min

    [JUL-239]The Present Top Mature Beauty Special Madonna Exclusive!! A Serious Stare...A Serious Feeling...4 Full Fucks Tsubaki Kato

  • kato camellia kaoru natsuki censoredmature womansingle workJULmadonnamametaro mamezawaJUL-239JUL239jul00239
    • 2020-06-01
    120 min

    [NACR-333]Female Editor Controlled By Old Writer, AIKA

  • aika censoredcreampieblowjobNACRplanet plusbito sakurananakuruNACR-333NACR333h-237nacr00333
    • 2020-06-01
    238 min

    [ZMAR-017]All Out! Rieko Hiraoka

  • rieko hiraoka censoredcreampiemature womanZMARplanet plusthe whole damn thingZMAR-017ZMAR017h-237zmar00017
    • 2020-05-29
    120 min

    [NEM-036]Genuine Abnormal Sex A Fifty-Something Stepmother And Her Stepson Chapter Thirty-Three An Alluring Stepmother Who Stimulates Her Stepson's Lust

  • hoka nakayama censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-036NEM036143nem00036
    • 2020-05-29
    120 min

    [NEM-035]True Abnormal Sex Stepson And Stepmom In Her 40s No.10 Slender Stepmom Takes In And Indulges In Her Stepson's Cock Yukiko Matsunaga

  • yukiko matsunaga censoredcreampiemature womanNEMglobal media entertainmentjiro sadogashimanewmomNEM-035NEM035143nem00035
    • 2020-05-29
    120 min

    [NEM-034]Forbidden Sex With The Bride's Mother Chapter Thirty-Three I Like My Stepmom Better Than My Wife... Rieko Hiraoka

  • rieko hiraoka censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-034NEM034143nem00034
    • 2020-05-28
    243 min

    [CVDX-404]A Slender Tiny Titty Old Lady - She's Bending Her Skinny Body In Creampie Temptation Sex - 20 Ladies 4 Hours

  • censoredcreampiemature womanCVDXcenter villageCVDX-404CVDX404h-086cvdx00404
    • 2020-05-23
    120 min

    [JUL-231]This Is A Video Record Of The Three Days I Spent Back In My Hometown Fucking My Former Classmate Who Had Now Become A Married Woman, Losing Our Minds Making Passionate Love Aoi Mukai

  • ai mukai censoredmature womansingle workJULmadonnajo asagiriJUL-231JUL231jul00231
    • 2020-05-23
    140 min

    [JUL-229]THE BEAUTIFUL WIFE 04 Misato Toyosaki 30 Years Old Her Adult Video Debut!!

  • toyosaki misato censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-229JUL229jul00229
    • 2020-05-17
    100 min

    [VOSS-192]This Housewife Pushing A Baby Carriage Just Gave Birth And Her Sensuality Is At Max Levels, And Her Nipples Are So Sensual And Hard That She'll Cum With Just A Touch!! My Brother's Wife Has Been Deprived Of Sex Since She Gave Birth,

  • censoredcreampiebig titsVOSSvenuspeterthe matures projectVOSS-192VOSS192voss00192
    • 2020-05-17
    100 min

    [VEC-420]I Became The Target Of My Wife's Lady Friends And I Was Not Allowed To Refuse Them Their Demands For Creampie Sex Reiko Sawamura

  • reiko sawamura honami takasaka masumi takasaka censoredcreampiemature womanVECvenuspetermegami venusVEC-420VEC420vec00420
    • 2020-05-03
    115 min

    [VEC-416]This Stepmom Has A Past. - The Unknown Breaking In History Of A Beautiful Stepmom - Elle Sato

  • sato l censoredcreampiemature womanVECvenuskaniemegami venusVEC-416VEC416vec00416
    • 2020-05-02
    126 min

    [JUL-219]Drowning In Father-In-Law In The Shower, Rana Kawai

  • kawai rana censoredcreampiemature womanJULmadonnanao masakiJUL-219JUL219jul00219



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download