mature woman bank




FC2GVHGMEMRBDSHKDNACXWANZVENUVEMANGODWAAAKBIMEYDCESDCHRVNATRHDKACAWDPPPDCJODAPOD

2020-10-16
96 min

[SS-004]Natural Love - Tsubasa Yano

  • aoyama nana really censoredbig titsSSglory questSS-004SS00413ss00004
    • 2020-10-19
    43 min

    305TRUMG-129 Shiori

  • amateur censoredamateurtrumgtrumg-129trumg129305trumg-129
    • 2020-11-07
    116 min

    [VENU-973]When Daddy Leaves The House, 2 Seconds Later This Stepmother And Stepson Start Having Sex Ayano Fuji

  • ayano kato censoredcreampiebig titsVENUvenussarufakecest winntersVENU-973VENU973venu00973
    • 2020-11-10
    58 min

    C0930 ki201110 Sayuri Okura 20years old

  • amateur uncensoredc0930
    • 2020-11-10
    82 min

    H0930 ki201110 Naomi Okajima 37years old

  • amateur uncensoredh0930
    • 2020-11-13
    54 min

    FC2PPV 1568229 Erotic Gal Yukopi ⑭ and Drive Ona Exposed Walk Karaoke F Benefits 54 Minutes + 35 Minutes

  • amateur uncensoredfc2
    • 2020-11-14
    251 min

    [LHTD-011]Take On The Challenge! The Big Vibrator Timer Shizuku Momoka Akane

  • asahi dro yoshino momoka censoredLHTDocean bookslight houseLHTD-011LHTD011171lhtd00011
    • 2020-11-23
    134 min

    [FLAV-256]The Famous S********l Idol Has A Huge Ass And Is Actually A Cheeky Slut Who Loves To Tempt Men - Erina Oka

  • hill erina censoredschoolgirlbeautiful girlFLAVdigital arkdigital ark digital arkFLAV-256FLAV256flav00256
    • 2020-11-24
    51 min

    [NYH-065]My Friend's Older Sister Tempting Me By Flashing Her Panties In Miniskirt! She Acts Like An Assertive Slut But In Actuality She Loves Being Dominated By The Cock - Yuri Sasahara

  • yuri sasahara censoredslutNYHdirectorsdirectorsnyanjiang houseNYH-065NYH0651nyh00065
    • 2020-12-05
    194 min

    [JUL-400]"The Contract Is For Three Days Of Filming" "I Asked My Neighbor If She'd Be Part Of My S*****t Film" Yuko Shiraki

  • shiraki yuko censoredmature womanslutJULmadonnahimu lockJUL-400JUL400jul00400
    • 2020-12-21
    59 min

    328HMDN-322 [College student x finest god milk celebrity wife] Personal shooting 32 years old God BODY beautiful wife whose husband is sexually weak and frustrated and violently fucked vagina and breast with big cock [Amateur / beautiful wife]

  • amateur censoredcreampiebig titshmdnhmdn-322hmdn322328hmdn-322
    • 2020-12-25
    138 min

    [MBM-251]A Big Tits Maid Provides Some Erotic, Fleshy Hospitality Get Your Fill Of Her Deep And Rich, Huge Titties

  • censoredbig titsMBMprestigejanhirombmMBM-251MBM251118mbm00251
    • 2020-12-31
    118 min

    [SSNI-958]Stuck At School Overnight With The Teacher I Hate Because Of A Storm... It's Just The Two Of Us And My Clothes Are Soaked - The Gross Old Perv Can See Everything - But There Was Nowhere Else To Go, So He Wound Up Fucking Me Until I Came

  • kodama rena censoredbig titsuniformSSNIs1 no 1 styletrendy yamaguchiSSNI-958SSNI958ssni00958
    • 2021-01-01
    53 min

    383REIW-031 Hina

  • amateur censoredamateurreiwreiw-031reiw031383reiw-031
    • 2021-01-09
    42 min

    279UTSU-480 Saeko

  • amateur censoredcreampiebig titsutsuutsu-480utsu480279utsu-480
    • 2021-01-09
    181 min

    [HJMO-451]The Freaky Twin Married Hostess Babes You've Heard About! Go Wild All Night Long With A Creampie Three-Some Harem!

  • censoredcreampieslutHJMOhajime kikakuHJMO-451HJMO451hjmo00451
    • 2021-01-15
    66 min

    [OTIM-051][Delivery Specialty] Continuous SEX In A Love Hotel With A C***dhood Friend Whose Libido Is Too Strong After 2 Weeks Of Abstinence Yui Satonaka

  • yui satonaka censoredcreampieuniformOTIMprestigeonetimeOTIM-051OTIM051118otim00051
    • 2021-01-15
    179 min

    [ZMEN-075]Amateur Cosplayer Gets D**gged, R**es, and Cums! 11

  • yamamoto renka yui satonaka censoredcosplayZMENz mennaveZMEN-075ZMEN075h-1371zmen00075
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-24
    240 min

    [ARAN-014]A Beautiful Girl In A Climax Hell Pictorial A Live Sacrifice Upon The Cruel Execution Chamber Watch Her Drip With Bittersweet, Dangerously Smelling Honey See Her Bearded Clam Twitch And Throb With Spasmic Ecstasy INFERNO BABE ULTRA FILM

  • censoredbeautiful girlbdsmARANbabyentertainmentshiroto musume kyoso kyokuARAN-014ARAN014aran00014
    • 2021-01-27
    121 min

    [PAKO-030]I Am Raising 9 Beautiful Witches Living In Fukuoka. Applying To Become THeir Husband, 45 Years Old

  • censoredanalamateurPAKOmercuryold lady fucking cafeteriaPAKO-030PAKO030h-1133pako00030
    • 2021-02-05
    123 min

    [HODV-21548]G*******ging Sex 30 Bukkake Cum Face Creampie Cum Shots Reika Hashimoto

  • reika hashimoto censoredsquirtingsingle workHODVh m pHODV-21548HODV215485642hodv21548
    • 2021-02-12
    81 min

    259LUXU-1379 Luxury TV 1365 Nasty! Outstanding proportions beauty likes the previous play and applies for re-appearance herself! Keeping the indecentness that captivates a man … The attitude of service that arouses the man’s heart is also w

  • amateur censoredamateurluxuluxu-1379luxu1379259luxu-1379
    • 2021-02-16
    64 min

    Pacopacomama 021621_435 This hot wife used to be a model Risa Aikawa

  • amateur uncensoredpacopacomama
    • 2021-02-22
    131 min

    [AGAV-048]S*****t Teacher With Beautiful Pale Skin And Juicy Colossal Tits Devours Teachers. The School Is In Total Disorder With Clothed Sex Happening Every Day. Yume Natsuki

  • natsuki yume censoredbig titsslutAGAVsexyoshida greatAGAV-048AGAV048agav00048
    • 2021-02-27
    240 min

    [GONE-030]5 Titty-Baring Amateur Girls And Of Course, We Always Love Titties. Girls With Lolita Faces And Big Tits Amateur Titty-Baring Highlights

  • censoredcreampiebig titsGONEmercurysmuGONE-030GONE030h-1133gone00030
    • 2021-03-12
    70 min

    453SSAN-019 Pakopako with Riho-san.

  • amateur censoredbig titsamateurssanssan-019ssan019453ssan-019
    • 2021-03-12
    141 min

    [NINE-045]Legendary Big Titty Married Escort Minori Will Visit You At Your House During The Pandemic ~ Emergency Sex Service At Your Doorstep ~

  • censoredcreampiebig titsNINEmercurychateaubriand hutNINE-045NINE045h-1133nine00045
    • 2021-03-12
    127 min

    [BOKD-216]Super Cute Transexual Porn Debut Sex After Having Aphrodisiac Rubbed On Anus And Cock Kohaku

  • censoredanalcreampieBOKDwe re she malessuginokiBOKD-216BOKD216h-995bokd00216
    • 2021-03-18
    59 min

    FC2PPV 1731019 [Treasure child] M sensitivity is good! Shuri-chan’s first shooting that is easy to live! The appearance that you really feel in a fierce blame is super chewy! I can’t stand being impatient … Insert it from myself and se

  • amateur uncensoredfc2
    • 2021-05-02
    110 min

    [AED-193]Family Fucking Fucking My 50 Something Step Mother Raw Yukie Mizukami

  • yukie mizukami censoredmature womansingle workAEDrubysusumu yanokuchieden rubyAED-193AED193aed00193
    • 2021-05-21
    187 min

    496SKIV-011 Narumi-chan (24)

  • amateur censoredcreampieamateurskivskiv-011skiv011496skiv-011
    • 2021-05-31
    118 min

    300MIUM-700 Get a beautiful girl without a doubt! !! A friendly apparel clerk who has been underwear in the back of her legs! I can’t stop looking at the beautiful ass! !! Super sensitive kitsuma with a jerky waist ● I was begged for a vaginal c

  • amateur censoredcreampieamateurmiummium-700mium700300mium-700
    • 2021-06-03
    74 min

    1Pondo 060321_001 Pussy Collection: 4 Different Pussies that Wrap up Penis So Gently Karin Morishita Marika Izumi Mika Fujimura Asuka Uchiyama

  • amateur uncensored1pondo
    • 2021-06-17
    118 min

    [BBTU-015]Submissive Girl With Big Tits Screams And Cums Like Crazy As She Has Her Huge Titties Covered With Cum Yuria Yoshine

  • yoshine yuria censoredbig titssingle workBBTUdogmatenunmy big titsBBTU-015BBTU015bbtu00015
    • 2021-06-25
    163 min

    [BANK-044]Raw Sex In The Outdoor Bath Sexy Slut With World Class Soft I-Cup Titties

  • censoredcreampiebig titsBANKpussy banktake chanBANK-044BANK044h-1495bank00044
    • 2021-06-25
    104 min

    [EKW-071]The Ultimate Treatment For Your Dick It's Almost Impossible To Get Reservations With This Titty Fucking Masseuse With Huge Boobs Hikari Sena

  • hikari sena censoredbig titsslutEKWwaap entertainmentk westcobra warpEKW-071EKW0712ekw00071
    • 2021-07-23
    160 min

    [LULU-087]My Colleague At My Part-Time Job Is A Big Tits Single Mother Who Let Me Stay At Her Place After I Missed The Last Train Home, And We Were Hanging Out, But She Was Unable To Hide How Horny She Was, So We Had Creampie Sex Until The Break Of D

  • ayaka muto censoredcreampiebig titsLULUlunaticsluminaxLULU-087LULU087lulu00087
    • 2021-08-03
    53 min

    SIRO-4595 [First Shot] [Big Breasts Fucking] [Dirty Ass Back] A Big Breasted Waitress Who Has An Adult Sex Appeal While Being 20 Years Old. Welcome A Meat Stick For The First Time In About 2 Years And Make Big Tits And Whip Buttocks Rippling .. Av Ap

  • amateur censoredbig titsamateursirosiro-4595siro4595siro-4595
    • 2021-08-09
    58 min

    1Pondo 080921_001 Piledriver BJ, Special Edition 18 Miku Aoyama Ryoka Sakurai Rena Hiiragi

  • amateur uncensored1pondo
    • 2021-08-20
    145 min

    [CAWD-270]Hono Konomi"s First Teasing/Big Dick/POV/Foursome. We Had Her Do Lots Of Things You Can Only Do In Porn

  • yoshimi hono censoredsingle workCAWDkawaiikimura hiroyukiCAWD-270CAWD270cawd00270
    • 2021-08-20
    116 min

    [CAWD-263]Creampied Endlessly By A Superior While Sharing A Room On A Business Trip... A Beautiful Fresh Faced Office Lady Falls For Her Superior"s Sensual Caresses And Hard Fucking Mina Konno

  • miina konno censoredcreampiesingle workCAWDkawaiioosaki hirokoujiCAWD-263CAWD263cawd00263
    • 2021-09-07
    52 min

    H0930 ki210907 Kumiko Moriwaki 33years old

  • amateur uncensoredh0930
    • 2021-10-08
    117 min

    [JUL-742]That Hot Female Employee Is Making Her Debut On The Madonna Label!! Rough Sex NTR With My Neighbor A Horny Dude Who Lives In A Trash-Filled Home Is Impregnating This Housewife With Cuckold Sex Kana Sasaki

  • natsuna sasaki censoredcreampiemature womanJULmadonnamishima rokusaburoJUL-742JUL742jul00742
    • 2021-10-28
    120 min

    [JRZE-083]First Time Filming My Affair, Yuri Fukayama

  • yuri miyama censoredcreampiemature womanJRZEcenter villageminami daichishoku ureJRZE-083JRZE083h-086jrze00083
    • 2021-12-13
    76 min

    259LUXU-1503 Luxury Tv 1495 A Beautiful Esthetician Who Applied For A Bold Reason Without Hiding It, Saying "I Really Like Sex …". Straddle A Man And Shake His Hips Violently, And He Is Disturbed While Having An Ecstatic Expression! (Ran

  • amateur censoredbig titsamateurluxuluxu-1503luxu1503259luxu-1503
    • 2021-12-30
    61 min

    [123021-001]Secret love with my colleague in a hotel room

  • ryu enami uncensoredcreampiecaribbeancom
    • 2022-01-01
    103 min

    [SQTE-397]Busty Goddess Honoka. J-cup Beautiful Woman With A Snake-like Tongue For Teasing. Honoka Tsujii

  • tsujii honoka censoredbig titsblowjobSQTEs cuteSQTE-397SQTE397sqte00397



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download