masturbation jav javcensored big tits high vision




FC2MEYDNACXWANZIPXAUKGAUKSDASDRBDNNPJMIDVHZGDSQTEVEMASTARSSHKDPPPDMVSDNATRBBANROYD

2020-12-05
178 min

[BF-621]S********l Comes To Her Teacher For Advice On How To Fuck Her Boyfriend And Ends Up Getting Nailed After School. Mahiro Ichiki

  • mahiro ichiki censoredcreampieuniformBFbefreeroku yonBF-621BF621bf00621
    • 2020-12-24
    158 min

    [SVDVD-833]Wanted: Amateur Young Wives To Take The Machine Vibrator Challenge! After They Get Their Pussies Nice And Stimulated By The Sensual Massage Machine, If They Can Avoid Squirting Until The End, Even After Receiving High-Speed Piston-Pounding

  • censoredcreampiesquirtingSVDVDsadistic villagesushi yokuboSVDVD-833SVDVD8331svdvd00833
    • 2020-12-24
    71 min

    [IENF-117]Every Detail Of This Black-Haired Babe's Pussy In Full View, Right Down To The Clit! No Pixelation - Continuous Over-The-Panties Masturbation

  • kamikawa starry sky ai kawana censoredIENFienergyienfIENF-117IENF1171ienf00117
    • 2020-12-26
    63 min

    SIRO-4342 [First shot] [Too cute cafe clerk] [Secretly to my boyfriend ..] A neat and clean woman whose embarrassing expression enhances her ejaculation spirit. Dirty underwear is stripped off and the waves of climax rushing over and over .. AV appli

  • amateur censoredamateursirosiro-4342siro4342siro-4342
    • 2021-01-15
    58 min

    444KING-025 Sakura (28)

  • amateur censoredcreampiebig titskingking-025king025444king-025
    • 2021-02-05
    115 min

    [PARATHD-3108](Emergency Broadcast) Hot Girls Are Pissing Themselves Live - Embarrassing Drenched Panties - Complete Edition

  • hebei haruna moe hazuki censoredPARATHDparadise tvPARATHD-3108PARATHD3108parathd03108
    • 2021-02-20
    102 min

    [YSN-539]I Heard That This Apartment Wife With A Big Ass Was Super Horny, So I Visited Her Home And Fucked Her Until She Was Panting And Moaning With Pleasure (LOL) Saya Minami

  • minami saya censoredcreampieamateurYSNnonYSN-539YSN539h-127ysn00539
    • 2021-03-07
    120 min

    [KCDA-298]Mature Woman With Big Breasts And A Nasty Body Kyoko Maki

  • maki kyoko censoredbig titsblowjobKCDAdigital arkdigital ark digital arkKCDA-298KCDA298kcda00298
    • 2021-03-07
    125 min

    [DNJR-045]"You Will Obey Me？" Impish Little Devil Takes Men By The Balls And The Superiority Complex Gets To Her Head - Erina Oka

  • hill erina censoredblowjobbeautiful girlDNJRdog daydreamersdog manDNJR-045DNJR045dnjr00045
    • 2021-04-07
    98 min

    [MSC-003](A Private Video Session) A Continuous Threesome Raw Creampie Fuck Fest! Saori-chan (20 Years Old) Is A Big Tits Legal Lolita Babe She's Got Black Hair, And Pretends To Be Neat And Clean, But She Loves Getting That Cum Swallowing Double

  • amateur censoredcreampieamateurMSCfuturefuture futureMSC-003MSC003
    • 2021-04-12
    65 min

    SIRO-4446 [First shot] [Beautiful apparel clerk] [Careful smile of semen bettori] An apparel clerk with snow-white skin appears. She is an adult-like girl with a calm behavior, but when her sensitive parts are stimulated, she begins to writhe in a cu

  • amateur censoredamateursirosiro-4446siro4446siro-4446
    • 2021-04-14
    120 min

    [OKSN-332]New Discovery! Gallons Of Breast Milk - Gorgeous H-Cup Colossal Tits & Big Nipples Dripping Breast Milk Are Proof Of Her Pleasure - Curvy, Light-Skinned Body Quivering

  • censoredbig titsmature womanOKSNabc delusion groupmom.com abc delusion groupOKSN-332OKSN332oksn00332
    • 2021-04-17
    163 min

    [CAWD-209]I'm No Longer Frigid - I've Got No Sexual Confidence, And I Want To Get More Sensitive... She Wanted To Lose Her Innocence And Learn To Feel More Pleasure, So She Decided To Do A Porno Yuyu Haruhi

  • sunny day yui censoreduniformbeautiful girlCAWDkawaiikannana dainanaCAWD-209CAWD209cawd00209
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-07
    118 min

    [IPX-657]"We Won't Tell My Sister, Ok？" Infidelity: My Girlfriend's Older Sister Wasn't Wearing Panties - I Couldn't Resist The Temptation To Cheat. Anna Kami

  • anna kami yukino censoredblowjobsingle workIPXidea pocketkyoseidishIPX-657IPX657ipx00657
    • 2021-05-14
    119 min

    [TPPN-192]Iron Plate! First Descent! The Dazzling Smile Of This Beautiful Half Japanese Girl Turns Into An Expression Of Agony As She Is Piston Fucked At High Speed!

  • censoredblowjobbeautiful girlTPPNteppanTPPN-192TPPN192tppn00192
    • 2021-05-22
    63 min

    10musume 052221_01 When I was playing with a dick with a sex toy, my body was burning Yuko Ikeda

  • amateur uncensored10musume
    • 2021-05-25
    120 min

    [SAN-004]Adorable Young Wife With Life Skin And An Incredible Body - Real Life Calligraphy Teacher's Bold Public Fucks Marino Yura

  • haruki sato serizawa tsumugi censoredbig titslesbianSANmothermother motherSAN-004SAN004118san00004
    • 2021-05-29
    106 min

    [XVSR-596]Seductive Escort Situations! Cowgirl Style Sex With Dirty Talk And Hard Pounding That Ends With A Creampie Hibiki Otsuki

  • otsuki sound censoredcreampieslutXVSRmax aikuzo yoshidacalenXVSR-596XVSR596xvsr00596
    • 2021-05-29
    79 min

    200GANA-2494 Seriously Nampa, first shot. 1642 Picking up students who want to become childcare workers! Have them change into baby clothes and play baby! "Ochi ○ Chin is delicious, isn’t it？ 』 Although I was confused by the sudden developme

  • amateur censoredamateurganagana-2494gana2494200gana-2494
    • 2021-06-01
    120 min

    [NACR-429]I Was Interested In My Mother-in-law's Breasts Shiori Tsukada

  • shiori tsukada censoredcreampiebig titsNACRplanet plusbito sakurananakuruNACR-429NACR429h-237nacr00429
    • 2021-07-02
    155 min

    [JUL-633]Married Woman Gushes Sweat And Bucks Her Hips While She Drains Your Creampie. Kana Mito

  • kana mito censoredmature womansingle workJULmadonnasatsugu koyamaJUL-633JUL633jul00633
    • 2021-07-16
    61 min

    FC2PPV 1925457 * Weekend Limited 3980⇒2980pt ★ First Shot ☆ Neat And Clean God Milk Slender Beauty Body Active Jd Asuka-Chan 20 Years Old ☆ Continuous Iki To Blame The Pussy ♥ Iron Man Girl Who Writhes In A Fierce Thrust ♥ Beautiful Breasts Shaking G

  • amateur uncensoredfc2
    • 2021-07-17
    150 min

    [JUL-660]A Drama Without Dialogue: No Words Needed, This Is The Ultimate Adulterous Sex Where Everything Is Told Through The Eyes And Fingers - Ayaka Mutou

  • ayaka muto censoredmature womansingle workJULmadonnanao masakiJUL-660JUL660jul00660
    • 2021-07-18
    46 min

    FC2PPV 1928021 Cosplay 18 Years Old. Unknowingly I Removed The Rubber And Made A Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2021-07-31
    239 min

    [MLSM-049]S Class Mature Woman Best Of Reiko Kobayakawa 4 Hours Big Tits And Nice Ass Madonna

  • kobayakawa reiko censoredcreampiebig titsMLSMmellow moonMLSM-049MLSM049mlsm00049
    • 2021-08-06
    132 min

    [DASD-901]Uniform Boy Hikari Tamaki

  • hikari tamaki censoredbeautiful girlsingle workDASDdasmasaki naoDASD-901DASD901dasd00901
    • 2021-08-06
    118 min

    [EBOD-847]Shacking Her Rare Bell Type Tits And Sucking The Hell Out Of Them. J Cup Delicate Mega-Tits Special Alice Kisaki

  • kisaki alice censoredbig titssquirtingEBODe bodyasagiri jouEBOD-847EBOD847ebod00847
    • 2021-08-08
    69 min

    345SIMM-658 Sperm Drinking System J ○! ？？ "Non", Who Is Cute Like A Small Animal, Is A Natural Active School Girl! For Non-Chan, Who Loves Him So Much That He Gets Out Of School And Comes To See Him, He Works Hard And Makes A Large Amount Of

  • amateur censoredcreampieuniformsimmsimm-658simm658345simm-658
    • 2021-08-12
    206 min

    [NHDTB-562]Miniskirt High School Groping, Fucked From Behind With Her Short Skirt Turned Up

  • censoredNHDTBnatural highsakurai vanillaNHDTB-562NHDTB5621nhdtb00562
    • 2021-08-13
    217 min

    [HUNTB-077]I"m In A Four-Way Secret Relationship With My Big Stepsister, Little Stepsister, My Step Niece, And My Step Cousins. 2 In The End, I Got Found Out, And So I Had Creampie Sex With All Of Them! And When My C***dhood Friend Saw What Was H

  • censoredcreampieHUNTBhunterkawajirihhh groupHUNTB-077HUNTB077huntb00077
    • 2021-09-09
    130 min

    [IENF-165]Nice Young Wife. Exclusive Picking Up Girls. Guy Gets Support For His Premature Cumming! "Hey？ You Just Came, But You"re Still Hard？" After Holding Back From Cumming A Ton, That Creampie Felt Amazing!

  • star ameri kiyoshi maihara censoredcreampieslutIENFienergytiger kosakaiienfIENF-165IENF1651ienf00165
    • 2021-09-11
    161 min

    [TPIN-012]The Melancholy Of The Auntie In The K*d"s Room - A Horny Stepbrother With His Stepmom And Stepsister

  • censoredcreampielesbianTPINtsubakihoinTPIN-012TPIN012tpin00012
    • 2021-09-24
    120 min

    [HMN-049]This girl is a perverted wolf in a delicate sheep"s clothing! Birth of a star. Non-stop plunging her pussy all day and unmasking her innocent facade. Kaede Hiiragi

  • hiiragi kaede censoredcreampiebeautiful girlHMNhonnakamamezawa mametarouHMN-049HMN049hmn00049
    • 2021-10-01
    66 min

    324SRTD-0250 Big Ass Woman Who Betrays Her Boyfriend With Drunk Momentum And Enjoys It Live (Renka Yamamoto)

  • amateur censoredcreampiebig titssrtdsrtd-0250srtd0250324srtd-0250
    • 2021-10-05
    60 min

    HEYZO 2623 Deep Kiss, Furious Sex -Fuck Me Lewdly!- – Jessica Takizawa

  • amateur uncensoredcreampieheyzo
    • 2021-10-08
    132 min

    [JUL-739]誰もが憧れる美人な女社長なのに…。ボクを異常に溺愛する麻妃叔母さん 北条麻妃

  • hojo asahi censoredcreampiemature womanJULmadonnayo sukeJUL-739JUL739jul00739
    • 2021-10-18
    82 min

    259LUXU-1454 Luxury TV 1471 A Pianist With An Attractive Plump Glamorous Body With An Adult Sex Appeal Appears In AV In Search Of A New World! The Body That Has Begun To Ripen Sensually Is Outstandingly Sensitive! The Pant Voice That Echoes Annoyingl

  • amateur censoredbig titsamateurluxuluxu-1454luxu1454259luxu-1454
    • 2021-11-03
    27 min

    FC2PPV 2401111 Until Today! Appearance! "# 2-2" An Innocent 18-Year-Old Girl Who Came To Tokyo. Creampie, Cum Swallowing And Dirtying Two Holes ♡ Both Feelings ♡

  • amateur uncensoredfc2
    • 2021-11-06
    70 min

    318LADY-391 Mikan (Shizuka Takano)

  • amateur censoredbig titsamateurladylady-391lady391318lady-391
    • 2021-11-13
    60 min

    519MAZOF-024 [Sexual Spring, Let Me Suck Up To Boobs] Municipal School Health Teacher 26 Years Old [Shaved] Delusional Masturbation With Students As Side Dishes, On Holidays, Saffle College Student And Dating Man Violently Fucked And Faint In Agony A

  • amateur censoredcreampiebig titsmazofmazof-024mazof024519mazof-024
    • 2021-11-23
    55 min

    10musume 112321_01 Cum Inside a Pigtail Plump Doll’s Pussy Chihiro Kodaki

  • amateur uncensored10musume
    • 2021-11-27
    123 min

    [JKSR-518]10AM: What Happened To School...Asuka - Asuka Momose

  • momose asuka censoredcreampiebeautiful girlJKSRbigmorkalobockeypinkjunkyJKSR-518JKSR51857jksr00518
    • 2021-12-03
    179 min

    [MIAA-537]A Sex Club Apartment Complex, Filled With Voluptuous Ladies An Apartment Wife With Colossal Tits And Erect Nipples Is Pressing Her Body Up Close For An Unlimited Ejaculation Course Special Yuria Yoshine Shiori Tsukada

  • yoshine yuria shiori tsukada censoredcreampiebig titsMIAAmoodyzsandmanminna no kikatanMIAA-537MIAA537miaa00537
    • 2021-12-19
    61 min

    [121921-001]The Girl with Snow White Boobs

  • mai amao uncensoredcreampiehandjobcaribbeancom
    • 2021-12-22

    [122221-001]The Undisclosed: My Anus, My Vagina

  • mai yoshino uncensoredanalcaribbeancom
    • 2021-12-30
    240 min

    [RD-1095]Fully Mature. A Married Woman Who Gets Wet Even Though She Says She Doesn"t Like It. 12 Women, 4 Hours.

  • amateur censoredmarried womanmature womanRDatena eizouRD-1095RD1095
    • 2021-12-31
    61 min

    355OPCYN-222 Miso (Suwon Miso)

  • amateur censoredbig titsamateuropcynopcyn-222opcyn222355opcyn-222



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download